SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000014154 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000014154
Domain Number 1 Region: 366-433
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.83e-19
Family TB module/8-cys domain 0.0005
Further Details:      
 
Domain Number 2 Region: 632-762
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.35e-17
Family Growth factor receptor domain 0.0063
Further Details:      
 
Domain Number 3 Region: 512-642
Classification Level Classification E-value
Superfamily Growth factor receptor domain 5.49e-17
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 4 Region: 1142-1204
Classification Level Classification E-value
Superfamily TB module/8-cys domain 5.76e-17
Family TB module/8-cys domain 0.00021
Further Details:      
 
Domain Number 5 Region: 726-831
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000785
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 6 Region: 845-968
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000314
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 7 Region: 319-374
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000559
Family EGF-type module 0.0071
Further Details:      
 
Domain Number 8 Region: 250-316
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.000000119
Family TB module/8-cys domain 0.0019
Further Details:      
 
Domain Number 9 Region: 1249-1299
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000276
Family EGF-type module 0.011
Further Details:      
 
Domain Number 10 Region: 1215-1260
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000513
Family EGF-type module 0.0072
Further Details:      
 
Domain Number 11 Region: 1306-1346
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.000000772
Family TB module/8-cys domain 0.0061
Further Details:      
 
Domain Number 12 Region: 1497-1542
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000295
Family EGF-type module 0.023
Further Details:      
 
Domain Number 13 Region: 954-1096
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000361
Family Growth factor receptor domain 0.023
Further Details:      
 
Domain Number 14 Region: 117-147
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000186
Family EGF-type module 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000014154   Gene: ENSOPRG00000015469   Transcript: ENSOPRT00000015494
Sequence length 1558
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_3798:107564:132651:1 gene:ENSOPRG00000015469 transcript:ENSOPRT00000015494 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RAALQASSPVAAVPVRHLKGFAALEPLAVPEASCRVQSCQPEKCKGHQQCRTPGPPGPSP
SPSPSKKQVSLSWQPLTLQEAQALLRLRRPWGPGGRALLLRRQPPQRTPASQARDLCPLI
CHNGGVCVKPDRCLCPPDFAGKFCQLHSSGARPPAPDMTDLTLSVYTMPLANHRDXXXXV
ASMVSVHVEHPQEASVVVHQVERVSGPWEEADAEAVARAEAAARSEAAAPYTVLAQSAPR
EDGYSDASGYGYCFRELRGGECASPLPGLRTQEVCCGGDGAPWGVHDCQPCSAHVGNAHR
MGAPDGPCPTGFERVNGSCEDVDECATGGRCQHGECANTRGGYTCVCPDGFLLDSSRSSC
ISQHVISEAKGPCFRVLREGGCSLPILRNITKQICCCSRVGKAWGRDCQLCPPFGSEGFR
EICPAGPGYHYSASDLRYNTRPLSQELPRVAVSRPRVPPATARPSTGVLPTYRPELRPEP
QPSHRPSHERPLPSIPAWTGPEITDSGAGLGMCQRNPQVCGPGRCIPRPSGYTCACDPGF
RLSPQGTHCLDVDECRRVPPPCAPGRCENTPGSFRCVCGPGFRAGPRGAECLDVDECHRV
PPPCDGGRCENTPGSFLCVCPAGYQAAPHGAGCQDVDECTQSPGLCGRGACTNLPGSFRC
VCPAGFRGSACEEDVDECAQEPPPCGPGRCDNTAGSYHCACPAGFRSRGPGAPCQDVDEC
ARSPLPCAYGRCENTHGSFQCVCPTGFQANAAGSACEDVDECENHLACPGQECVNTPGSF
QCRACPAGHQLHRGRCTDIDECSSGALCGPHGHCTNTEGSYRCSCAPGYRAPAGQPGPCA
DINECLEGDFCFPHGECLNTDGSFTCTCAPGYRPGPRGASCLDVDECSEEDLCQSGICTN
TDGSFECLCPPGHRASPDLASCLDVDECRERGPALCGSQRCENSPGSYRCVRDCDPGYHA
GPEGTCDDVDECQEYGPAICGAQRCENTPGSYRCTPACDPGYQPTPGGGCQDVDECRNRS
FCGAHAVCQNLPGSFQCLCDQYEGARDRRHCVDVNECETLQGVCGSAQCENVEGSFLCVC
PNSPEEFDPMTGRCVPPRTAAGSFPASQPQAPESPSLPARPPPPAPPRRPSTPRQGAVSS
GRRECYFDTAAPDACDNILARNVSWQECCCTVGEGWGNGCRIQQCPGPETAEYQSLCPHG
RGYLAPSGDLSLRRDVDECQLFRDQVCKSGVCVNTAPGYSCYCSNGYYYHTQRLECVDND
ECADEEPACEGGRCVNTVGSYHCTCEPPLVLDGSRRRCVSNESQSLDDNLGVCWQEVGPD
LVCSRPRLDRQATYTECCCLYGEAWXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPPTETYEVMEEEECG
IPDHCDPGRCVRVAEGFTCNCFLYYRLDITDMACVDINECDEAAAASPLCINARCVNT
Download sequence
Identical sequences ENSOPRP00000014154 ENSOPRP00000014154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]