SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000014156 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000014156
Domain Number 1 Region: 3-164,282-350
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.37e-46
Family FAD/NAD-linked reductases, N-terminal and central domains 0.00000259
Further Details:      
 
Domain Number 2 Region: 357-488
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 3.26e-32
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.00000503
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000014156   Gene: ENSOPRG00000015498   Transcript: ENSOPRT00000015496
Sequence length 489
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_4701:19439:146429:-1 gene:ENSOPRG00000015498 transcript:ENSOPRT00000015496 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EQPNFDLLVIGGGSGGLACAKEAAQLGRKVAVVDYVEPSPRGTKWGLGGTCVNVGCIPKK
LMHQAALLGGAIQDAGHYGWEVTQPVRHDWKKMAEAVQNHVKSLNWGHRVQLQERKVKYL
NVKASFVNKHTVRGVSKDGKETLLSADHIVIATGGRPRYPVLVEGAPEYGITSDDIFWLK
ESPGKTLVVGASXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRVPETRGLNLESAGVKTN
PENQKILVDAHDATSVPHIYAIGDVXXGRPELTPTAIMAGKLLAQRLFGQSADLMDYSNV
PTTVFTPLEYGCVGLSEEEAVARHGQEQIEVYHAYYKPLEFTVAERDASQCYIKMVCLRQ
PPQPVLGLHFLGPNAGEVTQGFALGIKCGASYAQVMRTVGIHPTCSEEVVKLRISKRSGL
DPTVTGCUG
Download sequence
Identical sequences ENSOPRP00000014156 ENSOPRP00000014156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]