SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000014195 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000014195
Domain Number 1 Region: 26-212
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.12e-36
Family FAD-linked reductases, N-terminal domain 0.0000000323
Further Details:      
 
Domain Number 2 Region: 263-354
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 3.22e-27
Family Electron transfer flavoprotein-ubiquinone oxidoreductase-like 0.00000388
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000014195   Gene: ENSOPRG00000015542   Transcript: ENSOPRT00000015542
Sequence length 358
Comment pep:novel genescaffold:pika:GeneScaffold_5400:8:12135:1 gene:ENSOPRG00000015542 transcript:ENSOPRT00000015542 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LCLHALKKRSCLPCTARWASTSAAPRLTTHYTVHPREQDKRWEGVSMERFAEEADVVIVG
AGPAGLSAAVRLKQLAAAQGKEIRVCLVEKAAQIGAHTLSGACLDPGAFEELFPDWKEKG
APLNTPVTEDRFGILTEKSRIPVPILPGLPMNNHGNYIVRLGHLVSWMGEQAEALGVEVY
PGYAAAEVLYHEDGSVKGIATNDVGIQKDGAPKXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXLWIIDEKNWKPGRVDHPGWGGPLGRHNYGGSFLFHLNE
REPLVALGLVVGLDYQNPYLSPFREFQRWKHHPSIRPTLEGGRRIAYGARALNEGGLQ
Download sequence
Identical sequences ENSOPRP00000014195 ENSOPRP00000014195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]