SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000014278 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000014278
Domain Number 1 Region: 26-220
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 5.9e-62
Family Proteasome subunits 0.00000000814
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000014278   Gene: ENSOPRG00000015640   Transcript: ENSOPRT00000015629
Sequence length 221
Comment pep:novel scaffold:pika:scaffold_13523:26700:28260:1 gene:ENSOPRG00000015640 transcript:ENSOPRT00000015629 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAVLGARGAGPAPAWGPEALAPDWENREVSTGTTIMAVQFDGGVVLGADSRTTTGSYI
ANRVTDKLTPIHDHIFCCRSGSAADTQAVADAVTYQLGFHSIELNEPPLVHTAASLFKEM
CYRYREDLMAGIIIAGWDPQEGGQVYSVPMGGMMVRQSFAIGGSGSSYIYGYVDATYREG
MTKEECLQFTANALALAMERDGSSGGVIRLAAIAESGVERQ
Download sequence
Identical sequences ENSOPRP00000014278 ENSOPRP00000014278

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]