SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000014318 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000014318
Domain Number 1 Region: 264-345
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.43e-19
Family Complement control module/SCR domain 0.000011
Further Details:      
 
Domain Number 2 Region: 83-148
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.01e-17
Family Complement control module/SCR domain 0.0000432
Further Details:      
 
Domain Number 3 Region: 140-214
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000119
Family Complement control module/SCR domain 0.0000848
Further Details:      
 
Domain Number 4 Region: 22-93
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000021
Family Complement control module/SCR domain 0.00019
Further Details:      
 
Domain Number 5 Region: 205-265
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000301
Family Complement control module/SCR domain 0.0000324
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000014318   Gene: ENSOPRG00000015679   Transcript: ENSOPRT00000015673
Sequence length 346
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_5330:554597:567002:-1 gene:ENSOPRG00000015679 transcript:ENSOPRT00000015673 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MISPLLILLSSFLCHVAIEGKSCPKPDDVPFSTVSPLKTSYEPGEQIRYICKPGYVSRGL
ITPITCLNVGIWTPTAMRCVPRVCPFAGILANGVVRYTTFEYPNTISFSCNPGFYLNGTS
SSQCTEEGKWSPSLPVCAPVTCPPPPVPKLAVLKLYKPSAGNNSFFGDTAVFECLPYYAM
FGNDTVTCTTHGNWTELPTCREVKCPFPTRPDNGFVNYPAKPVLHYKDKATYGCHDKFTL
DGPEEVECTKLGNWSAQPNCKASCELSVKKATVIFQGERVKIQDKFQKGLLHGQTISFYC
KNKERKCSYTEDARCDDGNIEIPKCFKEHKSYAFWKTDASEVKPCE
Download sequence
Identical sequences ENSOPRP00000014318 ENSOPRP00000014318

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]