SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000014376 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000014376
Domain Number 1 Region: 529-704
Classification Level Classification E-value
Superfamily gamma-Crystallin-like 2.16e-47
Family Crystallins/Ca-binding development proteins 0.00012
Further Details:      
 
Domain Number 2 Region: 717-842
Classification Level Classification E-value
Superfamily gamma-Crystallin-like 7.21e-30
Family Crystallins/Ca-binding development proteins 0.0046
Further Details:      
 
Domain Number 3 Region: 343-479
Classification Level Classification E-value
Superfamily gamma-Crystallin-like 6.45e-25
Family Crystallins/Ca-binding development proteins 0.003
Further Details:      
 
Domain Number 4 Region: 887-1016
Classification Level Classification E-value
Superfamily Ricin B-like lectins 9.47e-24
Family Ricin B-like 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000014376   Gene: ENSOPRG00000015729   Transcript: ENSOPRT00000015738
Sequence length 1018
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_492:501174:577038:1 gene:ENSOPRG00000015729 transcript:ENSOPRT00000015738 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAFQLEDTTVRLDQSMPVTVVYDQCRDLGYNDNKEQSNLAFVSQDEQDNSCFTILYDEP
LQDEDRYVCAEVRAPSFLFPEESPGRGPVLTCERSESRTDLVHHFEKGTKSDERSDSDSS
EVFLAVEAKRYKIYPLALSPIYEDDSSQEEILSNEVSPGHHGSSKSRESANQSSVLSLLQ
SVSERLKMNFDEDDGQPPEEEEEALHKGSLRTERREPVTLELPDPSITFYSDDDDQESSR
IPKNSYMLPDEPTTSNLQIGLWPEKTTFLQKSDLTSKLHSSLKSAYHQYLQASKTHSSEK
GARFGGILQEPVSKFFRVQDSQGRLNPFLENVDKQVLRCNPRPGKMVIYNLHGSKYKQEI
YCNIPDATSWSFPNGVLIKVVRGCWILYEKPHFQGQKCVLEEGEKVLNHDWILQNRKHPQ
RNVVLGSIRRILKDCSIPEIELCSQSDPACCPVFIQRAVPNLEELNIPKSMSFTVKSGVX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGGLKVEMPMNFEVIIYEKPHFHG
KYKEFSEHIDSVPNFLKDDDFHGIGSIRVIGGVWVAYEKEHFKGQQFLLEEGDFEDSSTY
GALSTPIMSFRYLQANFIESFITLFDSDLESGKFIDITNQEIPDLEEIGFGSETRSIHVK
SGVWVAYQQKFFCGEQYILEKGKYKCFFDWGGSSNTIMSIRPVQLEPLGINEPPHLLKAF
SKPGFQGECVDVTNEISDLTSFTPCSFKVLRGCWILYYQEDVCDHQCVLEEGLYADLTSC
GCPTSKVKSLKPIDYVFEEPSISLFALEHCEGRELHLEEAVNSVLNKDLHFYTQSVWVKS
GLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPAVYIRIKNRAQDEYLT
VTGTISDMRATSVCISPYSGKNTQIWHYCRGLFKSKANDTCLDVIGGRDTPGAKVALWTE
HGQLRQKWRLNKDGTISSYLSDQLVLDVKVGNYCDKTHVIVNQFLEGEATQKWDIEIL
Download sequence
Identical sequences ENSOPRP00000014376 ENSOPRP00000014376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]