SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000014487 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOPRP00000014487
Domain Number - Region: 167-228
Classification Level Classification E-value
Superfamily Tropomyosin 0.0255
Family Tropomyosin 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000014487   Gene: ENSOPRG00000015870   Transcript: ENSOPRT00000015859
Sequence length 231
Comment pep:novel genescaffold:pika:GeneScaffold_641:524117:524812:-1 gene:ENSOPRG00000015870 transcript:ENSOPRT00000015859 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IVTLNLVRQDIAKPESTSETAVNQETDLGSFHTPFENLNSTTVTLTTSDSEDIQQSLETQ
ELLEKTPNHQANPTLTNSMEIKSQENPSLLNPINQTVEELNTDKESVSAIFVPTEDSKPV
INCFTPARIEITEVEDTDTEDSFCRNTDYGTEVLQMEHSYCRQDANKENLWQKVSKLHSK
VTLLELQEQQTLGRLKSLEALIRQLTQENWLSEENVKVIENHFTTYEVTMT
Download sequence
Identical sequences ENSOPRP00000014487 ENSOPRP00000014487

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]