SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000014507 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000014507
Domain Number 1 Region: 423-838
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.77e-129
Family RNB domain-like 0.00000000225
Further Details:      
 
Domain Number 2 Region: 221-315,366-414
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.86e-38
Family Cold shock DNA-binding domain-like 0.00051
Further Details:      
 
Domain Number 3 Region: 844-920
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000000000291
Family Cold shock DNA-binding domain-like 0.0057
Further Details:      
 
Domain Number 4 Region: 63-156
Classification Level Classification E-value
Superfamily PIN domain-like 0.0000726
Family PIN domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000014507   Gene: ENSOPRG00000015854   Transcript: ENSOPRT00000015883
Sequence length 953
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_2242:60583:82459:-1 gene:ENSOPRG00000015854 transcript:ENSOPRT00000015883 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKSKTFLKKTRAGGVMKIVREHYLRDDIGCGVPGCAACGSAHEGPVLEPRPRDPASSLC
PQPHYLLPDTNVLLHQIDVLEDPVIRNVIVLQTVLQEVRNRSAPVYKRIRDVTSNQEKHF
YTFTNEHHRKTDVEDGQENANDKNDKAIQVADKSYNKHLKRVGGDEFQVIFKSSDINKKV
IKGSVTHIACEEYIKSLTANPELVDRLACLSDEGKKIESGKIIFSEHLSLSKLQQGIKSG
FSLQGTFRASRENYLEATVWIHGDTEENKEIILQGLKHLNRAVHEDVVAVELLPKSQWVA
PSSVVLHDEGQNEDDMEKEEERERMLKTAVSEKMLKPTGRVVGIIKRNWRPYCGMLSKSD
IKESRRHLFTPADKRIPRIRIETRQASTLEGRRIIVDIDGWPRNSRYPNGHFVKNLGDVG
EKETETEVLLLEHDVPHQPFSQAVLSFLPKMPWSITEKDMKHREDLRHLCVCSVDPPGCT
DIDDALHCRELGNGNLEVGVHIADVSHFIRPGNALDQESARRGTTVYLCEKRIDMVPELL
SSNLCSLRCDVDRLAFSCIWEMNHNAEILKTKFTKSVINSKASLTYAEAQMRIDSATMND
DITTSLRGLNKLAKILKRRRIENGALTLSSPEVRFHMDSETHDPIDLQTKELKETNSMVE
EFMLLANISVAKKIHEEFSEHALLRKHPAPPPSNYEILVKAAKSKNLEINTDTAKSLADS
LDRAESSVFPYLNTLLRILATRCMMQAVYFCSGMDNDFHHYGLASPIYTHFTSPIRRYAD
IIVHRLLAVAIGADCTYPELTDKHKLADICKNLNFRHKMAQYAQRASVAFHTQLFFKSKG
IVSEEAYILFVRKNAIVVLIPKYGLEGTVFFEEKDKPKPRLVYDDEIPSLKVEDTVFHVF
DKVKVRIMLDASNLQHQKIRMALVEPQIPGVSVPMDISNVDCEPGRKKRKLEK
Download sequence
Identical sequences ENSOPRP00000014507 ENSOPRP00000014507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]