SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000014579 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000014579
Domain Number 1 Region: 42-158
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 1.44e-43
Family Interleukin 17F, IL-17F 0.0000159
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000014579   Gene: ENSOPRG00000015973   Transcript: ENSOPRT00000015962
Sequence length 163
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_5511:71846:78231:-1 gene:ENSOPRG00000015973 transcript:ENSOPRT00000015962 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTVKMLKDTALVKSLLLLMLGFTLLREGAAWKKPKAGHGTLPKPGNCPPLENNSVRVDIR
ILSQKQGVPITHDFQNRSISPWDYNITRDPHRFPSEIAEARCRYSGCINAQGEEDNSMNS
VPIQQEFLVLRREPQGCSHSFRLEKVRVTVGCTCVTPIVRHAS
Download sequence
Identical sequences ENSOPRP00000014579 ENSOPRP00000014579

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]