SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000014603 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000014603
Domain Number 1 Region: 141-407
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.6e-81
Family Eukaryotic proteases 0.00000016
Further Details:      
 
Domain Number 2 Region: 16-75
Classification Level Classification E-value
Superfamily GLA-domain 2.02e-23
Family GLA-domain 0.00019
Further Details:      
 
Domain Number 3 Region: 62-102
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000179
Family EGF-type module 0.00074
Further Details:      
 
Domain Number 4 Region: 105-154
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000474
Family EGF-type module 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000014603   Gene: ENSOPRG00000015989   Transcript: ENSOPRT00000015986
Sequence length 420
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_235:4318:8944:1 gene:ENSOPRG00000015989 transcript:ENSOPRT00000015986 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FVAREEAHGVLRRQRRANTFLEELWSGSLERECKEELCSFEEAREIFQSPERTKQFWISY
SDGDQCSSNPCQNGGSEDQLQSYICLCLPDFEGRNCDKNKNDQLICAYENGGCAQYCNDH
IGDKRSCRCHEGYMLQPDGVSCSPAVEYPCGRIPVLEKMGASNAQGRIVGGKVCPKGECP
WQAALMVNNGTLLCGGSLVNPHWVVSAAHCFDKLRSLRNLTIVLGEHDLSKNQWDEQVRR
VAQIIVPDKYTPGRTDHDIALLRLRRPVVLTDHVVPLCLPERGLSERTLASVRFSRVSGW
GQLLDRGASARQLMAIHVPRLMTQDCLEQRTARGSPEITENMFCAGYLDGSQDACKGDSG
GPHATPYHGTWYLTGVVSWGEGCAAVGHFGVYTRVSRYTEWLSRLMRSKPGPSFVRAPFP
Download sequence
Identical sequences ENSOPRP00000014603 ENSOPRP00000014603

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]