SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000014703 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000014703
Domain Number 1 Region: 67-374
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 4.76e-85
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0013
Further Details:      
 
Domain Number 2 Region: 361-471
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 4.09e-17
Family Anticodon-binding domain of Class II aaRS 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000014703   Gene: ENSOPRG00000016102   Transcript: ENSOPRT00000016094
Sequence length 475
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_4597:101920:103347:-1 gene:ENSOPRG00000016102 transcript:ENSOPRT00000016094 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGLLARCRALAVLAAGSRQLQGRVPCRSHHSASGKGQRLLLSRIFQAQNLREDQVLSQE
GKSGELTCKSQRLMLQVGLIAPASPGCYHLLPYTVRALEKLVRVIDQEMQAVGGQKVDLP
SLSPAELWRATQRWDLMDKELLRLRDRHGKEYCLGPTHEEVITALVASQKNLSYKQLPFL
LYQVTRKFRDEPRPRFGLLRGREFYMKDLYTFDSSAEAAQHTYGLVCDAYHSLFHRLGLR
VVQAQADVGSIGGTMSHEFQLPVDIGEDRLAVCPSCSFAANTETLDSSQTNCPKCQGPLT
KTKGIEVGHTFYLGTKYSSIFQAQFTNAEGKPCLAEMGCYGLGVTRILAAAIEALATEDS
VRWPSLLAPYQVCLIPPKKGSKEAAAAELTGHLYNRIVEAVPQLRGEVVLDDRTHLTIGN
RLKDANKLGYPFVVIAGRRALEEPAHLEVWCQNTGESFFLSEEGVLDLLAQVQVV
Download sequence
Identical sequences ENSOPRP00000014703 XP_004588853.1.84141 ENSOPRP00000014703

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]