SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000014760 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000014760
Domain Number 1 Region: 10-186
Classification Level Classification E-value
Superfamily Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 3.79e-60
Family Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 0.0000000191
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000014760   Gene: ENSOPRG00000016159   Transcript: ENSOPRT00000016153
Sequence length 198
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_2422:2240:13165:1 gene:ENSOPRG00000016159 transcript:ENSOPRT00000016153 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TEPEEPAEERKFRVLVGVTGSVAALKLPLLVSGLLEVPGLEVAVVTTERAKHFYSPQDVA
VTLYSDADEWEMWKQRSDPVLHIELRRWADLMLVAPLDANTLGKVASGLCDNLLTCVVRA
WDRSKPLLFCPAMNTAMWEHPITAQQVGQLKAFGYIEIPCVAKKLVCGDQGLGAMAEVET
IVDKVREILSQLGSSQHS
Download sequence
Identical sequences ENSOPRP00000014760 ENSOPRP00000014760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]