SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000014793 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000014793
Domain Number 1 Region: 1203-1369
Classification Level Classification E-value
Superfamily C-type lectin-like 2.7e-53
Family Endostatin 0.000000627
Further Details:      
 
Domain Number 2 Region: 39-235
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.87e-34
Family Laminin G-like module 0.027
Further Details:      
 
Domain Number 3 Region: 851-1008
Classification Level Classification E-value
Superfamily C-type lectin-like 2.01e-24
Family Endostatin 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000014793   Gene: ENSOPRG00000016158   Transcript: ENSOPRT00000016191
Sequence length 1375
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_5125:83950:193233:1 gene:ENSOPRG00000016158 transcript:ENSOPRT00000016191 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPRKNRQDWRLLRLMWLSALLFTVTQTRAATETASQSHLDLTELIGVPLPSSVSFITGY
GGFPAYSFGPDANVGRPARTLLPPTFFRDFAISVTVKPSSTHGGVLFAITDAFQKVIYLG
LRLSGVEDGQQRIILYYTEPGSHVSQEAAVFAVPVMTNKWNHFSLMIQGEEVTLLLDCED
QGHVLFQRSSRPLAFEPSAGIFVGSAGATGLEKFTGSIQRLTLHPDPRMPEEQCEAEEAS
ASGETSGLQEADGVAEILEAITYTQAPPQEAKVEPIDAPLVPTSPTEDTELSGEPTPEGT
LDTANFSVVLHGSPEPGSGEILNDTLEGLPTVGGDPTTDMGSGAGPFLGVTAGEGLDAEG
PGRTFGEAEATEGPTPAVSSQNPEEGATPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAQ
VHVEMEGQAAPEGEEDEAEESFSRSPIPSVPAGPTVGAEPEGSSLXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGPEGQPGLDGAS
GLPGMKGEKGARGPIGSAGEKGDPGNRGLPGPPGKNGQVGTPGVMGPPGPPGPPGPPGPG
CTMGTGSEDIEGSGSISLLNEPRLSGPTLPSGPKGEKGDQGPKGDRGVDGASTVGPPGPR
GPPGRIEVLSSALINMTHGALNFSDIPELMGPPXXXXXXXXXXXXGPRGPKGDTGVPGFP
GLKGEQGEKGEPGAILTGDIPLERLRGKKGEPGVHGAPGPMGPKGPPGHKGEFGLPGRPG
RPGLNGLKGAKGDRGVMMPGPPGLPGPPGPPGPPGAVVNIKGAVFPVPTRPHCKTPVGTT
HSVDPELIXXXXVKGEKGSWGLPGSKGEKGDQGAQGPPGPPVDPTYLRHILNSLKRGNGD
RGVKGDKGDSNDNFFVSGPPGLPGSPALTGQKGETVIGPQGPPGVPGLPGPPGFGRPGAP
GPPGPPGPPGPPAILGAAVALPGPPGPPGQPGLPGIRNLITAFSSMHEMLQQAHLVIEGT
FVYLRDSTEFFIRVRDGWKKLQLGELIPIPADSPPPPALASNPHQLQPQPPLNPVLSANY
ERPALHLVALNTPFSGDIRADFQCFQQARAAGLLSTYRAFLSTHLQDLSSIVRKAERYSL
PIVNLKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMTDPSWPQKVVWHGSSTHGVR
LVDKYCEAWRTADMSVTGFASQLSTGKILDQKAYSCANRLIVLCIENSFMTDARK
Download sequence
Identical sequences ENSOPRP00000014793 ENSOPRP00000014793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]