SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000014843 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000014843
Domain Number 1 Region: 108-446
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 1.12e-38
Family Gamma-glutamyltranspeptidase-like 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000014843   Gene: ENSOPRG00000016253   Transcript: ENSOPRT00000016247
Sequence length 486
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_4510:149275:152343:-1 gene:ENSOPRG00000016253 transcript:ENSOPRT00000016247 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGTAEPVLYHKLQLWEPSVEEEEEEEEAEEETVEPLVPYPWQPQDYARYKFAGLPGTCA
RIAAALLLLVVACSLAIRQLQARDDSNSDPTALPPGGHTHHSGVYHHAAIISPAGQELLV
AGGNIVDAGVGAALCLAVVHPHTTGLGAVFWGLFHNSSSGNSTALTSGPAKALAPGLGLP
ATLPTLHLLHARFGHLSWPHLLLGPTKLAQEGFTVDATLAKALAAQGTGNLCPLLCHADG
TPLGLGARATNPQLADVLRRAAHAPTPDLAEEALLSLLARDLGLEAPSTGPVPTLLPALQ
LPVPQGLLLTTPSPSAGPEMLMKLEAALHSEGPSPDPCPSLLPTAGSLGSSVLATVDSSG
SVLLLTSSLNGSFGSGHLSQSTGVLLSNLGAGATPSTWACPLILRGSPGDTEADVLGLVA
SGTPQMAKAVTHALFSYLAGTQTQQQQGPTGSPRTCGQGTLLQVAAYAEHAHVSSVPKDC
CPFQGL
Download sequence
Identical sequences ENSOPRP00000014843 ENSOPRP00000014843

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]