SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000014851 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000014851
Domain Number 1 Region: 54-195
Classification Level Classification E-value
Superfamily C-type lectin-like 9.8e-35
Family C-type lectin domain 0.0000281
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000014851   Gene: ENSOPRG00000016259   Transcript: ENSOPRT00000016256
Sequence length 197
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_881:936928:945613:1 gene:ENSOPRG00000016259 transcript:ENSOPRT00000016256 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKIGLVICXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKDGDLKTQVEKLWREVNALKE
MQALQTVCLRGTKFYKKCYLASEGLKHYHEANEDCISKGGTLVIPRNSDETNALRDYGKK
SMPGVNDFWLGINDMVTDGKFVDVNGATVSFLNWDRAQPNGGKRENCVLFSQSAQGKWSD
EVCRSSKRYICEFTIPE
Download sequence
Identical sequences ENSOPRP00000014851 ENSOPRP00000014851

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]