SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000014857 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000014857
Domain Number 1 Region: 371-540
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.44e-49
Family Nuclear receptor ligand-binding domain 0.0000000661
Further Details:      
 
Domain Number 2 Region: 84-167
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.96e-30
Family Nuclear receptor 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000014857   Gene: ENSOPRG00000016263   Transcript: ENSOPRT00000016261
Sequence length 541
Comment pep:known_by_projection scaffold:pika:scaffold_609:252991:365963:1 gene:ENSOPRG00000016263 transcript:ENSOPRT00000016261 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSSCNSGGLQASLKHGFTPMGAGLPDRRGRPIPAGGRLVMLPKVETEALGLTRSHGEQG
QMPENMQVSQFKMVNYSYDEDLEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKRY
TCIENQNCQIDKTQRKRCPYCRFQKCLSVGMKLEAVRADRMRGGRNKFGPMYKRDRALKQ
QKKALIRANXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXVDDQMKLLQNCWSELLILDHIYRQVVHGKEGSIFLVTGQQVDYSIIASQA
GATLNNLMSHAQELVVKLRSLQFDQREFVCLKFLVLFSLDVKNLENFQLVEGVQEQVNAA
LLDYTVCNYPQQTEKFGQLLLRLPEIRAISMQAEEYLYYKHLNGDVPYNNLLIEMLHAKR
A
Download sequence
Identical sequences ENSOPRP00000014857 ENSOPRP00000014857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]