SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000014945 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000014945
Domain Number 1 Region: 172-260
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 7.12e-23
Family Proteasome subunits 0.00000707
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000014945   Gene: ENSOPRG00000016373   Transcript: ENSOPRT00000016365
Sequence length 265
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_777:14274:21063:-1 gene:ENSOPRG00000016373 transcript:ENSOPRT00000016365 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVDMALASVLETPLPVNQRGFFGLGGRTDLLDLGPGSPRDGLSLTAPGWGVPEEPGIEMV
HGTTTLAFKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLYYVDSEG
KQISGATSVGSGSVYAYGVMDRSYSYNLEVEEAYDLARRAIYQATYRDAYSGGAVNLYHV
REDGWIRVSSDNVADLHDKYSGSTP
Download sequence
Identical sequences ENSOPRP00000014945 ENSOPRP00000014945

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]