SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000015001 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000015001
Domain Number 1 Region: 15-252
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.49e-46
Family Nuclear receptor ligand-binding domain 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000015001   Gene: ENSOPRG00000016438   Transcript: ENSOPRT00000016427
Sequence length 255
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_1470:286211:288143:-1 gene:ENSOPRG00000016438 transcript:ENSOPRT00000016427 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGACPCQTAAGRPAILYALLSPGFRARPSVPPSRNHCLCREHRPVRLRTPHRTCQQALDI
LAKMVAFLRNLPSFCQLPPEDQRQLLRSSWGPLFLLGLAQDTVTFEVIEAPVPSILKKIL
LEEPTCGTGRGQLPDRPQPSLAAVQWLQCCLESFCNLELGPKEYAYLKGIILFNPGVPGL
QTSSHIGRLQQEAHWALCEVLEPWRAAGQGRLAQVLLTASTLKSIPPGLLGDLFFRPIIG
DTDIAGLLEDMLLLR
Download sequence
Identical sequences ENSOPRP00000015001 ENSOPRP00000015001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]