SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000015195 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000015195
Domain Number 1 Region: 73-205
Classification Level Classification E-value
Superfamily C-type lectin-like 1.17e-31
Family C-type lectin domain 0.000000444
Further Details:      
 
Domain Number 2 Region: 53-80
Classification Level Classification E-value
Superfamily Triple coiled coil domain of C-type lectins 0.0000000177
Family Triple coiled coil domain of C-type lectins 0.00098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000015195   Gene: ENSOPRG00000016644   Transcript: ENSOPRT00000016637
Sequence length 208
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_4156:167522:169725:1 gene:ENSOPRG00000016644 transcript:ENSOPRT00000016637 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELWAASLLLCLFSLLTQVIAESPTLRPPNPKVKKAAANVKKDIVSPKMVEELKNQLDSL
AQEVALLKEQQALQTVCLKGTKVHMKCFLAFAQAKTFHQASEDCISRGGTLGTPQSGSEN
DALYEYLRQSLGAEAEIWLGLNDMAAEGAWVDMTGGSITYKNWETEITAQPDGGKAENCA
ALAGAANGKWFDKRCRDALPYICQFAIV
Download sequence
Identical sequences ENSOPRP00000015195 ENSOPRP00000015195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]