SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000015228 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000015228
Domain Number 1 Region: 27-68
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000095
Family HI0933 N-terminal domain-like 0.052
Further Details:      
 
Domain Number 2 Region: 382-454
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000399
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000015228   Gene: ENSOPRG00000016673   Transcript: ENSOPRT00000016674
Sequence length 684
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_2176:25298:64977:1 gene:ENSOPRG00000016673 transcript:ENSOPRT00000016674 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSVRGCGRCIAASLSKHPLPLAQFSTDSATARTRHFDVVVIGGGHAGTEAAAAAARCGS
RTLLLTHRVDTIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPEDQLPCYLTHTNPQVDKIVLGNLH
LNSHVQETTRGPRYCPSIESKVLRFPNRQHQVWLEPEGMDSDLIYPQGLSVTLPAELQEK
MITCIRGLEEARMVQPGYGVQYDYFDPRQISPSLETHLVQRLFFAGQINGTTGYEEAAAQ
GVIAGINASLRVSHKPPFVVSRTEGYIGVLIDDLTTLGTNEPYRMFTSRVEFRLSLRPDN
ADTRLTFRGYKEAGCVSQQRYEKACWMSSLEEGISVLKSVEFSSCKWKKLIPEASISATR
SQPVSALDVLKHEEVDMESLAKAVPDLFKKYIQCRKLAERLKIEATYESVVLLQLQEIKE
AQQDEALQLPEDLDYLTIRDVSLSHEVREKLHFTRPQTIGAASRIPGVTPAAIINLLRFV
KTAQQRQVAMNESPGTNGVCDTNQ
Download sequence
Identical sequences ENSOPRP00000015228 ENSOPRP00000015228

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]