SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000015236 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000015236
Domain Number 1 Region: 118-128,237-471
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.44e-47
Family Nuclear receptor ligand-binding domain 0.00026
Further Details:      
 
Domain Number 2 Region: 62-136
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.69e-25
Family Nuclear receptor 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000015236   Gene: ENSOPRG00000016686   Transcript: ENSOPRT00000016682
Sequence length 485
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_2301:175069:409320:-1 gene:ENSOPRG00000016686 transcript:ENSOPRT00000016682 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QPPALGRRFRRRGHRSWRSSRASAGPEQQHRMERDEPPPPRNXXXXXXXXXXXXXXXDRA
EQRTCLICGDRATGLHYGIISCEGCKGFFKRSICNKRVYRCSRDKNCVMSRKQRNRCQYC
RLLKCLQMGMNRKXXXXXXXXGGRNKSIGPVQISEEEIERIMSGQEFEEEANHWSSHGDS
DHGSPGHRASESSQPSPGSTLSSSRSVELNGFMAFREQYVGMSVPPHYQYIPHLFSYSGH
SPLLPPQARSLDPQSYSLIHQLVSAEDLEPLGTPMLIEDGYAVTQAELFALLCRLADELL
FRQIAWIKKLPFFCELSIKDYTCLLSSTWQELILLSSLTVYSKQIFGELADVTAKYSPSD
EELHRFSDEGMEVIERLIYLYHKFHQLKVSNEEYACMKAINFLNQDIRGLTSASQLEQLN
KRYWYICQDFTEYKYTHQPNRFPDLMMCLPEIRYIAGKMVNVPLEQLPLLFKVVLHSCKT
SVGKE
Download sequence
Identical sequences ENSOPRP00000015236 ENSOPRP00000015236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]