SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000015364 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000015364
Domain Number 1 Region: 85-113
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000395
Family EGF-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000015364   Gene: ENSOPRG00000016829   Transcript: ENSOPRT00000016826
Sequence length 116
Comment pep:novel scaffold:pika:scaffold_52754:3503:5063:1 gene:ENSOPRG00000016829 transcript:ENSOPRT00000016826 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGRLRVRLLLVIGLTSQLILPGKSYQRERHKVAVNSSAAPRQSLPRNWTGGAAGEPSTR
VWGWKLEDPGPYSRALAERAPPRLRCCQNGGTCVLGSFCVCPAHFTGRHCEHDQRH
Download sequence
Identical sequences ENSOPRP00000015364 ENSOPRP00000015364

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]