SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000015421 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000015421
Domain Number 1 Region: 2-521
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 4.63e-126
Family Gamma-glutamyltranspeptidase-like 0.00000418
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000015421   Gene: ENSOPRG00000016882   Transcript: ENSOPRT00000016887
Sequence length 521
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_5482:60476:68926:-1 gene:ENSOPRG00000016882 transcript:ENSOPRT00000016887 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AILEQQGSPVDATIATLVCTGVINPQSMGLGGGVIFTIYNATTGKVEIINARESVPANSD
PDLLTQCDRAMPLGKGSQWIGVPGELRGYAEAHRRHGRLPWAQLFQPTIELGATSMPSIL
SQFLNSSFLRPSLTTSSLRQLFFNGTEPLQPQGPFPWPALAATLETVAAEGAEAFYKGRL
GRMLVEDVAKEGGRLTMKDLGDFHPEVLDALEMSLGDYTLYSPPPPAGGAILSFILNVLR
GFNFSADSVASPEGSVDMYHHLVETFKFAWGQKWRLWDPRSHRDMQNVSLPLLGEELARH
TRQQIDGSGDHRLSHYSLERTWDHRMGTSHVSVLGEDGSAVSATSTINTPFGAMVYSPRT
GILLNNELLDLCWRRPPGSSITPAPATDVPGGCGAPVPGERPPSSMVPSILISAARGSKL
VIGGAGGELIISAVVQAVMNKLWLGLDLSEAIAAPILHVGSQGRVEFEPSFSQEVQKGLR
ECGHRQSQRPFFLNVVQAVAQEGTCVYAVSDSRKGGEAAGY
Download sequence
Identical sequences ENSOPRP00000015421 ENSOPRP00000015421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]