SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000015423 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000015423
Domain Number 1 Region: 158-262
Classification Level Classification E-value
Superfamily C-type lectin-like 5.91e-39
Family Link domain 0.01
Further Details:      
 
Domain Number 2 Region: 268-352
Classification Level Classification E-value
Superfamily C-type lectin-like 1.23e-24
Family Link domain 0.0024
Further Details:      
 
Domain Number 3 Region: 49-155
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000146
Family V set domains (antibody variable domain-like) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000015423   Gene: ENSOPRG00000016896   Transcript: ENSOPRT00000016889
Sequence length 354
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_149:327807:346759:-1 gene:ENSOPRG00000016896 transcript:ENSOPRT00000016889 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTFLLLVLTSICWADRLSDNHTLGRDRVIHIQAENGPRLLVEAEQAKVFSHRGGNVTLP
CKFYRDPTAFGSGLHKIRIKWTKLTSDYLKEVDVFVSMGYHKKTYGGYQGRVFLKGGSEN
DASLVITGLTLEDYGRYKCEVIEGLEDDTAVVALDLQGVVFPYFPRLGRYHLNFHEAQQA
CLEQDAMIASFDQLYDAWRGGLDWCNAGWLSDGSVQYPITKPREPCGGQNTVPGVRNYGF
WDKDKSRYDVFCFTSNFNGRFYYLIHPTKLTYDEAVQACRHDGAQIAKVGQLFAAWKLLG
YDRCDAGWLADGSVRYPISRPRRRCSPTEAAVRFVGFPDKKHKLYGVYCFRSYN
Download sequence
Identical sequences ENSOPRP00000015423 ENSOPRP00000015423 XP_004586277.1.84141

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]