SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000015584 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000015584
Domain Number 1 Region: 2010-2177
Classification Level Classification E-value
Superfamily C-type lectin-like 4.2e-29
Family C-type lectin domain 0.00097
Further Details:      
 
Domain Number 2 Region: 1781-1852
Classification Level Classification E-value
Superfamily CalX-like 0.00000000000405
Family CalX-beta domain 0.0051
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000015584
Domain Number - Region: 389-426
Classification Level Classification E-value
Superfamily Purple acid phosphatase, N-terminal domain 0.0085
Family Purple acid phosphatase, N-terminal domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000015584   Gene: ENSOPRG00000017066   Transcript: ENSOPRT00000017073
Sequence length 2178
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_2851:39537:173995:-1 gene:ENSOPRG00000017066 transcript:ENSOPRT00000017073 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKPLCQGAAHLLSLLLGWASPTFVSVNHGLRVMKGSSTFLSADDLKFAVPKEKDACKVEV
VMNEPITQRVGKLTPQIFDCHFLPNEVKYTHNGCPLLDEDTVKLRLYRFTETDTFTETFV
LRVYLLEPDCNIIRRSDNVLQVSEFYSLSQAIDKNLLRFEYDRMANMECTISLDPVRTQL
PAWGQMVLVESRPKEPRGDQPHSFFPESSLETELKCPGGRCALELKKIGSLRVSCEEFLL
MGLRYQHLAPPSPNVDYISIQLDLTDSRSNIVYKKSESAWLPVYIRAGFPNQIPRAAFMA
TFILEVDQFILTSLTTSVLDCEEDETPKPLLVFNITKAPLQGYVTHLLDHTRPISSFTWQ
DLSDMQIAYQPPNSSHPERRQYEVELEVYDFFFERSTPITVHISIRTTDTNGPRVSWNTG
LNLLEGQSRAITWEQFQIVDNDDINAVCLVTVDGLQHGRLTLRGGKAFLFTVADLQAGVV
RYHHDDSDSTKDFVVFRIFDGSHSIRHKFPINILPKDDSPPFLITNVVIELEEGQAILLQ
GSLLRASDMDSSDDYIFFNITTPPQAGEIMKKPGPGLIGYPVPGFLQRDLFNGIIYYRHF
GEEIFEDYFEFVLWDSHEPPNLSMPQVVTIHITPVDDQLPEEAPGVSRHLVVKETEVAYI
TKKHLHFIDPEAHDGELFYTVTMPPFYSLSHRYLDAGKLFMVDSIPKLIKNPSALGLKSF
TQHAVNHLKVAYMSPLQDIGPHVRHVQFTFSISNQHGSTVHGICFNITILPVDNQVPEVF
TNLLRVTEGGERIISTEHILVSDMDTVLDNVHFSLQRLPPHGGVQLDGFPLTPGDTFSWG
DLCTLKVRYQHDGSEVLQDDILLEVTDGTNSVEFVLYVEVFPINDEPPVLKADLIPMMHC
SEGGEVVITSEHVFATDADSDDLKLMFVVARAPEQGVVSKAGVPVSQFSQGDIISGTVTY
KHTGGEIGLLPCFDTITLVVSDGDAGPFVNGCCYNGPNPFVPLHESFPVYDLNITVHPVD
NQPPLLAVGATFFVDEGLSAGLTINHLSATDPDTAEDDLEFILVSSPQFGYLENTLPSVG
FEKSNVGISIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXVCEGQGKELDSSIIHAADLDIPKDPLLLSVVHKPRHGLLISGNF
SKDFPLNKQPASPHQKHELVHNFSLELLRTGMSLVYVHDDSESLVDDFTIQLSDGKHKIL
QTISIEVIPVNDEKPTLSKRAEIAVNMGETRIISSAILSAIDEDSPRENIYYLFEKLPQN
GQLQLKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXEIVILAKPLVLAKGDRGFLTPTTLLAVDGTHKPEELLYVITSPPQYGQ
VEYVRYPGIPITSFSQMDIAGRTVCYIHRSTASVLNDTFRFLVSNGLHTKHGVFEITLEP
VDRALPVVTRNKGLRLVQGTLGLLSPDCLQLSDPDTPVENLTFLLAQLPQHGQLYLWGTA
LLQRHFTQQDVDGGGVTYEHSGGNSLLDGFTFVATDGKNRGFVVDGRMCKEPVPFTIQVD
LVDRAAPRLTRLHSPSQVGLLKNGCYGIYITSRVLKASDPDTEDDQIIFKILRGPQHGHL
EDTTTGELIHERFSQRDLNSKTILYIISPSLMEVNSDLVEFQIMDPSGNSATPQXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVNQVSAAVGKDFTVTPSKLIQF
DPGMSTKMWNIAITYDGLEEDDEIFEVILNSPVNAVLGTKTKAAVKILDSKGGQCYSSHS
FNQSKHKAWEKRFWSLRPPGSSSPTTARPFHLQRGRLLSPKQQANTKGGSLRGFDAIHLP
PRRLRAQKNGKTVRPSSVYRNGTDIIYQYHGMVSLKLEDDSSPAHQRKTKESNINQPQRT
IKVAELPQADKVESTTDSHFPRQELLPSFLKNCTLDLKGLFHFEESIQKLYQCNGIAWKA
WNLQTKVMEDSCPPGWHHHSGYCHTLVTEQKETWNAATQACRKQHLGSLVTVFSSQHMRW
LWDFSGRKPFWIGLNNQLHPGHWEWAGGEPVIFTSWRRGPPRRVKPGRNCVLVQRPGKWQ
LKDCRKGKVHSYVCSRKL
Download sequence
Identical sequences ENSOPRP00000015584 ENSOPRP00000015584

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]