SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000015701 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000015701
Domain Number 1 Region: 44-166
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-22
Family Spermadhesin, CUB domain 0.0021
Further Details:      
 
Domain Number 2 Region: 464-562
Classification Level Classification E-value
Superfamily Kelch motif 0.000000000000011
Family Kelch motif 0.01
Further Details:      
 
Domain Number 3 Region: 671-837
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0000000000000297
Family C-type lectin domain 0.014
Further Details:      
 
Domain Number 4 Region: 244-316
Classification Level Classification E-value
Superfamily Kelch motif 0.00000000314
Family Kelch motif 0.023
Further Details:      
 
Domain Number 5 Region: 976-1022
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000339
Family Laminin-type module 0.0088
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000015701
Domain Number - Region: 164-201
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00191
Family EGF-type module 0.081
Further Details:      
 
Domain Number - Region: 16-47
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00407
Family EGF-type module 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000015701   Gene: ENSOPRG00000017197   Transcript: ENSOPRT00000017204
Sequence length 1342
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_602:3786:112168:1 gene:ENSOPRG00000017197 transcript:ENSOPRT00000017204 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAAAAVSGSAAARTMECDRRCVNGGRCNPGTGQCVCPAGWVGEQCQHCGGRFRLTGSSGF
VTDGPGNYKYKTKCTWLIEGQPNRIMRLRFNHFATECSWDHLYVYDGDSIYAPLIAAFSG
LIVPERDGNETVPEVVATSGYALLHFFSDAAYNLTGFNITYNFDMCPNNCSGRGECQISN
VSNTVKCECSENWTGESCDIPHCPDDCGFPHRGICNSSEARGCSCFLGWQGPGCSVPIPA
NQSFWTQEEYSNLKLPRASHKAVVNGNIMWVVGGYMFNHSDYNMVLAFDLASREWLPLNR
SVNNVEGRYGHSLTLYKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTILKDSRFFRYLHTAVIVSG
TMLVFGGNTHNDTSMSHGAKCFSSDFMAYDIACDRWSVLPRPDLHRDVNRFGHSAVLHNS
TMYVFGGFNSLLLSDILVFTLEQCGAHRSEAACSAAGPGIRCVWDTGSSQCLSLELGIGD
QAEKLKSEFPKRTHDHDRCQHTDCYSCTANTNDCHWCNDHCVPVNHSCTEGQISIFRYDN
CPKDNPMYYCNKKTSCRSCALDQNCQWEPRNQECIALPENICGIGWHLVGNSCLKITTAK
ENYDNAKLSCRNHNAFLASLTTQKKVEFVLKQLRIMQSSQSLXXXXXXXXXXXXXXXXXX
XXXXXXSPFTNTLLQWMPSEPSDAGFCGILSEPSTRGLKAATCINPLNGSVCERPANHSA
KQCRTPCALRTACGECTSGSSECMWCSNMKQCVDSNAYVASFPFQCMEWYTMSSCPPENC
SGYCTCSHCLEQPGCGWCTDPSNTGKGKCIEGSYKGPMKMPSQAPTGNFYPQPLLNSSMC
LEDSRYNWSFIHCPACQCNGHSKCINQSICEKCENLTTGKHCETCISGFYGDPTNGGKCQ
PCKCNGHASLCNTNTGKCFCTTKGVKGDECQLCEVENRYQGNPLKGTCYYTLLIDYQFTF
SLSQEDDRYYTAINFVATPDEQNRDLDMFINASKNFNLNITWAASFSAGTQAGEEMPVVS
KTNIKEYKDSFSNEKFDFRNHPNITFFVYVSNFTWPIKIQIAFSQHSNFMDLVQFFVTFF
SCFLSLLLVAAVVWKIKQSCWASRRREQLLREMQQMASRPFASVNVALETDEEPPDLIGG
SIKTVPKPIALEPCFGNKAAVLSVFVRLPRGLGGIPPPGQSGLAVASALVDISQQMPIAY
KEKSGAVRNRKQQPPAQPGTCI
Download sequence
Identical sequences ENSOPRP00000015701 ENSOPRP00000015701

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]