SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000015771 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOPRP00000015771
Domain Number - Region: 404-441
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 0.0358
Family Nuclear receptor ligand-binding domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000015771   Gene: ENSOPRG00000017278   Transcript: ENSOPRT00000017279
Sequence length 1128
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_3991:46054:111411:1 gene:ENSOPRG00000017278 transcript:ENSOPRT00000017279 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLTSLYEHKLAEKLTILNDRGQGVLIRMYNIKKTCSDPKTKPHFLLEKSMESSLKFISK
KFPNIDVRNGTQHLGPIHREKTEIIRFLTNYYQSFVDVMEFRDHVYELLNTIDACQCHFD
INLNFDFTRSYLDLIVTYTSVILLLSRIEDRRVLIGMYNCAHEMLHGHGDPSFARLGQMV
LEYDHPLKKLTEEFGPHTKAVSGALLSLHYLFLRRNQGAEQWRSAQLLSIISSPPAMISP
ANSDTMACEYLSVEVMERWIIIGFLLCHGCLNSNSECQKLWKLCLQGSLYITLIRDDVLQ
VHKVTEDLFSSLKGYSKRVADIKESKEHVIANSGQFHSQRRQFLRVAVKELEIVLSDEPG
LLGPKALFAFMALSFIRDEVTWLVRHTENVTKTKTPEDYADSSIAELLFLLEEIRALVRK
HIKVIQQYHLQYLARFDALVLSDVIQNLSVCPEEESVIMSSFVSTLNSLNPKQVESGEKF
EFAGLRLDWFRLQAYTSVAKAPLHLHENPDLAKVMNLIVFHSQMLDSVEKMLVETSDLSI
FCFHLRTFEKMFAVTLEEPSMLRYAIAFPLICAHFVHCTHEMCPEEYPHLKNHGLHHCNS
FLEELAKQTSNCVLEICAEQRNLSEQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXA
IVWLSGYNATTQEIARPSELLAGVKAYIGFIQSLTQFLGADASRVIRNALLQQTQPLDSA
GEQTITTLYTNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMRAL
AELLGPYGMKFLSENLMWHVTSQIVELKKLVVENMDVLVQIRSNFSKPGLMASLLPQLTG
AENVLKRMTIIGVILSFRAMAQEGLREVFSSHFPFLMGPIECLKEFVTPDTDIQVTLSVF
ELASAAGVGCDIDPALVAAIANLKTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVASVSLLQLGQETDKLKTR
NRESVSLLMRLVVEESSFLTLDMLEACFPYVLLRNAYREVSRAFHLNR
Download sequence
Identical sequences ENSOPRP00000015771 ENSOPRP00000015771

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]