SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000015897 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000015897
Domain Number 1 Region: 3-62
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-21
Family Spermadhesin, CUB domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000015897   Gene: ENSOPRG00000018672   Transcript: ENSOPRT00000018984
Sequence length 68
Comment pep:novel scaffold:pika:scaffold_17082:8543:8751:-1 gene:ENSOPRG00000018672 transcript:ENSOPRT00000018984 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EACGGTLRGTSSSISSPHFPSEYENNADCTWTILAEPGDTIALVFTDFQLEEGYDFLEIS
GTEAPSIW
Download sequence
Identical sequences ENSOPRP00000015897 ENSOPRP00000015897

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]