SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000015927 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000015927
Domain Number 1 Region: 2-134
Classification Level Classification E-value
Superfamily Globin-like 3.93e-52
Family Globins 0.0000011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000015927   Gene: ENSOPRG00000018385   Transcript: ENSOPRT00000018983
Sequence length 154
Comment pep:novel scaffold:pika:scaffold_6113:39334:40744:-1 gene:ENSOPRG00000018385 transcript:ENSOPRT00000018983 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVHFTAEEKAAIEHTWKLVNVEDVGGEALGRLLLVYPWTQRFFDNFGNLSSASAIMGNPK
VKAHGKKVLSAFGEAVKNMDDLKNTFAHLSELHCDKMHVDPENFKLLGNVLIIVLAKYFG
KEFTPEVQLAWQKLGWSGHCLGPQVSLNPLPLGL
Download sequence
Identical sequences ENSOPRP00000015927 ENSOPRP00000015927

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]