SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000015956 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000015956
Domain Number 1 Region: 33-344
Classification Level Classification E-value
Superfamily (Trans)glycosidases 9.58e-94
Family Bee venom hyaluronidase 0.0000347
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000015956
Domain Number - Region: 385-405
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00762
Family EGF-type module 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000015956   Gene: ENSOPRG00000018723   Transcript: ENSOPRT00000018412
Sequence length 421
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_4769:443921:445550:-1 gene:ENSOPRG00000018723 transcript:ENSOPRT00000018412 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTMWLGLALVLGVAMCLGYSWPLQAPERAFSVLNVPLAHCEARHGVRLPLGALGIVSNWG
QHFRGQNITIFCKNFGLYPYLGPMGTAHNGGIPQAVPFEHHLLQAASQIHCSLGPGFTGL
AVLDWEEWYPLWTGNFGRRHTYKEASWAWAQQAFPDQDPQKQLHKARTGFEQTARALIED
TLQLGQELQPQGLWGFYHYPGCGNGWQGKAANCTGHCHAATIARNTQLHWLWAASSTLFP
NIYLPPRLPPVHWQTFVRHHEEAFRRAMVGHPHPLPVLAYACLTYWHSGRFLVQDDLVQT
RGVSAALGVAGVVLWGNLSLSNSKEECWHLHDYLVGTLGPYVINVTRAAMMCSRQRCHGR
GRCARRDPGQTEAFLHLGPDASHRAWEAFRCQCYWGWAGPTCQEPLGLKKEAKDWGSAPA
P
Download sequence
Identical sequences ENSOPRP00000015956 ENSOPRP00000015956

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]