SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000016008 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000016008
Domain Number 1 Region: 5-50
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000867
Family EGF-type module 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000016008   Gene: ENSOPRG00000019192   Transcript: ENSOPRT00000018443
Sequence length 110
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_3929:13043:91347:-1 gene:ENSOPRG00000019192 transcript:ENSOPRT00000018443 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPTDHEEPCGSNHRSFCLNGGICYVIPTIPSPFCRCIENYTGARCEEVFLPSASIQTKSH
LFAALVAVAVLVTLTIGALYCLCRKGPLQRTSTAQYDVSMVETSSPNVRH
Download sequence
Identical sequences ENSOPRP00000016008 ENSOPRP00000016008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]