SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000016190 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000016190
Domain Number 1 Region: 37-76
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000000432
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000016190   Gene: ENSOPRG00000018631   Transcript: ENSOPRT00000018294
Sequence length 92
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_2639:302132:310664:1 gene:ENSOPRG00000018631 transcript:ENSOPRT00000018294 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALLPSELQWPDPGVLSPKQLEKLREFKIQTRIANEKYLRAHKEVEFLISGFLRELFLKR
PENIREFAADYFTDPRLPNKIHRQLIKDKKAA
Download sequence
Identical sequences ENSOPRP00000016190 ENSOPRP00000016190

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]