SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000016196 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000016196
Domain Number 1 Region: 37-225
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.35e-26
Family Laminin G-like module 0.0055
Further Details:      
 
Domain Number 2 Region: 293-335
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000198
Family EGF-type module 0.075
Further Details:      
 
Domain Number 3 Region: 254-288
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000243
Family EGF-type module 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000016196   Gene: ENSOPRG00000018416   Transcript: ENSOPRT00000018499
Sequence length 342
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_5254:6878:74613:-1 gene:ENSOPRG00000018416 transcript:ENSOPRT00000018499 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DELLCECKLYCKLCQFSCENNAGNGATCVPKSGTDFVCLCPYGKSGPLCTDAINITQPRF
SGTDALGYTSFLAYSWISDISFNYEFRLKFQLANNHSALQNNLMFFTGQKGHGLDGDDFL
AVGLLDGCVVYNYNLGSGLASVKSEPLDLNLEIHTVYLGRSFRKGWLKVDDHKNKSIISP
GRLVGLNVFSEFYVGGYSEYLPDLLPNGASFKNGFQGCIFTLQVRTEKDSHLRGLGNPEG
HPSAGRTVGQCDASPCHVMKCGNGGTCIEDGATAYCKCTAGWKGTFCMDAVSTCDPEHDP
PHHCSKGATCVSLPHGYTCYCPLGTTGIYCEQGKTETQLILF
Download sequence
Identical sequences ENSOPRP00000016196 ENSOPRP00000016196

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]