SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000000168 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000000168
Domain Number 1 Region: 145-281
Classification Level Classification E-value
Superfamily Cadherin-like 5.14e-26
Family Cadherin 0.00013
Further Details:      
 
Domain Number 2 Region: 260-376
Classification Level Classification E-value
Superfamily Cadherin-like 4.28e-16
Family Cadherin 0.00052
Further Details:      
 
Domain Number 3 Region: 76-157
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000157
Family Cadherin 0.0015
Further Details:      
 
Domain Number 4 Region: 384-495
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000628
Family Cadherin 0.0068
Further Details:      
 
Domain Number 5 Region: 508-593
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000942
Family Cadherin 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000000168   Gene: ENSOPRG00000000186   Transcript: ENSOPRT00000000186
Sequence length 990
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_2148:114627:143381:1 gene:ENSOPRG00000000186 transcript:ENSOPRT00000000186 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAWLLPRNTGALAILMAFVLVHGELRLEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXITSDFQATQKITYRISGVGIDQPPFGIFAVDPNTGDINITAIVDREET
PSFLIMCRALNALGQDVEKPLILTVKILDVNDNYPVFSQNIFTGEIEENSASNSLVMKLN
ATDADEPGHLNSKIAYKIVSQEPAGIPMFLISRNTGEVRTLTNSLDREQVSSYRLVVSGA
DKDGDGLSTECECSIKVKDVNDNFPTLRASQYSASIKENTLSSELLRFEVTDLDEKFTDN
WLAVYFFTSGNEGNWFEIETDPRTNEGILKVVKALDYEQMQNMQFSIGVRNKAEFHQSVI
SQYRVQPIPVTIRIIDVKEGIAFRPASKTFTVQKSISSTKLINYVLGRYEAIDEDTGKAA
SSVRYIMGRNDGGLLAIDLKTAQIKFVKNINRDSTFIVNKTITAEVLAIDENTGRTCTGT
VFVEVPSFNENCPTIVLENTTICSSSPVVVVSARTLERDKYAGPYRFSLEDHSLKLPPGT
WSITTLNATSAQLRARQPVTPGEYRVPLVLTDREGRQCEMPESLTLEVCQCDDRGFCGKT
GPIREPTRRQPSWSLGPAAIGLLLLGLLLLLLAPLLLLTCDCGTSALGGGTGGFIPVPDG
SEGTIHQWGIEGAHPEDKEITNICVPPITANGAEFMESSEVCTNTYAGGTVVEGASGMEL
ATKFGTAAASGAAAGFGAAGGLGSTGQSGTMRTRHSTGGTSRDYADGTISMNFLDSYFSQ
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDSFLDSLGPKFKK
LVEISLGMDEEVQQAQWPSTDSSAGIGSWGQPKIYSHQAQRADFVRCQTLSGGPGGLVLS
ASGSFQPAIPIPDPLQQANYLVRETYSASASSTLMQPSSAVFDPLLTPNVIVTERIISPM
ASTAGNLLIPTELRGTCSGPCTEDPCSRLI
Download sequence
Identical sequences ENSOPRP00000000168 ENSOPRP00000000168

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]