SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000000519 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000000519
Domain Number 1 Region: 2138-2269
Classification Level Classification E-value
Superfamily Cadherin-like 8.28e-35
Family Cadherin 0.00056
Further Details:      
 
Domain Number 2 Region: 2656-2766
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-29
Family Cadherin 0.00028
Further Details:      
 
Domain Number 3 Region: 1305-1408
Classification Level Classification E-value
Superfamily Cadherin-like 3.85e-29
Family Cadherin 0.0011
Further Details:      
 
Domain Number 4 Region: 238-372
Classification Level Classification E-value
Superfamily Cadherin-like 7e-29
Family Cadherin 0.00054
Further Details:      
 
Domain Number 5 Region: 1200-1311
Classification Level Classification E-value
Superfamily Cadherin-like 5.14e-28
Family Cadherin 0.0003
Further Details:      
 
Domain Number 6 Region: 1929-2052
Classification Level Classification E-value
Superfamily Cadherin-like 5.85e-28
Family Cadherin 0.00047
Further Details:      
 
Domain Number 7 Region: 3386-3506
Classification Level Classification E-value
Superfamily Cadherin-like 1.34e-27
Family Cadherin 0.00078
Further Details:      
 
Domain Number 8 Region: 3076-3187
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-27
Family Cadherin 0.00091
Further Details:      
 
Domain Number 9 Region: 2040-2142
Classification Level Classification E-value
Superfamily Cadherin-like 3.43e-27
Family Cadherin 0.0011
Further Details:      
 
Domain Number 10 Region: 1831-1940
Classification Level Classification E-value
Superfamily Cadherin-like 1.36e-26
Family Cadherin 0.00074
Further Details:      
 
Domain Number 11 Region: 1404-1531
Classification Level Classification E-value
Superfamily Cadherin-like 1.43e-26
Family Cadherin 0.0011
Further Details:      
 
Domain Number 12 Region: 3175-3283
Classification Level Classification E-value
Superfamily Cadherin-like 2.57e-26
Family Cadherin 0.00075
Further Details:      
 
Domain Number 13 Region: 2249-2360
Classification Level Classification E-value
Superfamily Cadherin-like 7.57e-24
Family Cadherin 0.0016
Further Details:      
 
Domain Number 14 Region: 2970-3073
Classification Level Classification E-value
Superfamily Cadherin-like 2.28e-23
Family Cadherin 0.00081
Further Details:      
 
Domain Number 15 Region: 1729-1830
Classification Level Classification E-value
Superfamily Cadherin-like 2.43e-22
Family Cadherin 0.00067
Further Details:      
 
Domain Number 16 Region: 2760-2858
Classification Level Classification E-value
Superfamily Cadherin-like 8.57e-22
Family Cadherin 0.001
Further Details:      
 
Domain Number 17 Region: 2859-2968
Classification Level Classification E-value
Superfamily Cadherin-like 9.42e-22
Family Cadherin 0.0019
Further Details:      
 
Domain Number 18 Region: 3496-3599
Classification Level Classification E-value
Superfamily Cadherin-like 7e-21
Family Cadherin 0.001
Further Details:      
 
Domain Number 19 Region: 3949-4061
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.91e-21
Family Laminin G-like module 0.015
Further Details:      
 
Domain Number 20 Region: 3285-3390
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-20
Family Cadherin 0.0022
Further Details:      
 
Domain Number 21 Region: 129-250
Classification Level Classification E-value
Superfamily Cadherin-like 5.42e-19
Family Cadherin 0.0022
Further Details:      
 
Domain Number 22 Region: 2566-2662
Classification Level Classification E-value
Superfamily Cadherin-like 1.36e-18
Family Cadherin 0.0036
Further Details:      
 
Domain Number 23 Region: 1513-1619
Classification Level Classification E-value
Superfamily Cadherin-like 3.43e-16
Family Cadherin 0.0021
Further Details:      
 
Domain Number 24 Region: 3842-3968
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000455
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 25 Region: 2348-2395
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000514
Family Cadherin 0.0031
Further Details:      
 
Domain Number 26 Region: 68-135
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000971
Family Cadherin 0.0086
Further Details:      
 
Domain Number 27 Region: 1622-1736
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000742
Family Cadherin 0.0069
Further Details:      
 
Domain Number 28 Region: 4420-4457
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000234
Family EGF-type module 0.011
Further Details:      
 
Domain Number 29 Region: 4304-4393
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000192
Family Laminin G-like module 0.043
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000000519
Domain Number - Region: 3601-3691
Classification Level Classification E-value
Superfamily Cadherin-like 0.00298
Family Cadherin 0.02
Further Details:      
 
Domain Number - Region: 3796-3854
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00888
Family EGF-type module 0.011
Further Details:      
 
Domain Number - Region: 2476-2517
Classification Level Classification E-value
Superfamily Cadherin-like 0.0614
Family Cadherin 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000000519   Gene: ENSOPRG00000000553   Transcript: ENSOPRT00000000572
Sequence length 4918
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_4865:157:204525:1 gene:ENSOPRG00000000553 transcript:ENSOPRT00000000572 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLAATRAAGRPWLPLHSLSVFQLLRALWLLWLLPGPAQVLGTEQRQVFQVLEEQPPGTL
VGTIQTRPGFTYRLSESHALFAINSSTGALYTTATIDRESLPSDVVNLVVLSSAPTYPTE
VRVLVRDLNDNAPVFPDPSIVVTFKEDSSSGRQVILDTATDADIGSNGVDHRSYRIIRGN
EAGRFRLDITLNPSGEGAFLHLVSKGGLDREVTPQYQLLVEVEDKGEPKRRGYLQVNVTV
QDINDNPPVFGSSHYQAGVPEDAVVGSSVLKVAAADADEGTNADIRYRLQDEGTPFQMDA
ETGLITVREPLDFEARRQYSLTVQAMDRGLPSLTRAEALIQLLDVNDNDPVKFRYFPATS
RYASVDENAQVGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXESLMRRRGTAFSFTVIATQGLPQPLKDQVTVHVYMKDIN
DNAPKFLKDFYQATISESAANLTQVLRVSASDVDEGNNGLIHYSVIKGNEERQFAIDSAT
GQVTLIGKLDYEATPAYSLVIQAMDSGTISLNSTCTLHIDILDENDNTPSFPKSTLFVDV
VENMRIGELVSSVTATDSDSGDNADLHYSITGTNNHGTFSISPNTGSIFLAKKLDFETQS
LYKLNITAKDQGRPPRSSTMSVVIHVRDFNDNPPSFPPGDIFKSIVENIPIGTSVISVTA
HDPDADINGQLTYTIVQQMPRGNHFDIDEVKGTIYTNAEIDREFANLFELTVKANDQAVP
IETRRYALKNVTILVTDLNDNVPMFISQNALAADPSAVIGSVLTTIMAADPDEGANGEVE
YEIINGDTNTFIVDRYSGDLRVASALVPSQLIYNLIVSATDLGPERRKSTTELTVILQGL
DGPVFTQPKYITILKEGEPIGTNVISIEAASPRGADAPEEYYIVSVRCEEKTVGRLFTIG
RHSGTIQTAAILDGEKGACLYLGGVYAIKKSTAFPRTQRAEVEITLQDINDNPPVFPTDT
LDLTVEENIGDGSKIMQLTAMDADERANALVTYTIISGADDSVRIDPESGDLIATKRLDR
ERRSKYSLLVRADDGLQSSDMRINITVSDVNDHTPKFSRPVYSFDIPEDTTPGSLVAAIL
ATDDDSGVNGEITYIVNEDDEDGIFFLNPVTGVFNLTRVLDYEAQQYYILTVRAEDGGGQ
FTTIRVYFNILDVNDNPPVFSLNSYSTSLMENLPLGSTVLVFNVTDADDGVNSQLAYSIA
SGDSLGQFTVDNSGVLKVVKALDRESQSFYNLVVQVHDLPQHPASRFTSTAQVSIILLDV
NDNPPTFLSPKLTYIPENTPIDTVVFKAQATDPDSGPNSYIEYTLLNPWGSKFSIGTIDG
EVRLTGELDREDVSNYTLTVVATDKGQPSLSSSTEVVVMVLDINDNNPVFAQALYKVEIN
ENTLTGTDIIQVFAVDGDEGTNGQIRYGIVGGNANQEFRIDSVTGAITVAKPLDRERTPN
YLLTVQATDRGSTPRTDTSTVSIILLDINDFVPIFELSPYSVNVPENLEILPRTILQVVA
RDDDQGSNSKLSYALFAGNEDNAFTLSTSGELKVTQSLDREAKEHFVLVLTAIDSGSPAL
TGTGTVSVIVDDVNDNVPTFASKMYFTSIPEDAPTGTDVLLVNASDADVSTNAVVXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXGSFVLAVTLPHADIGTNSELHYSLMGRNSEKFHFDPLRGXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXVTVRFVIDADFVRAKEQTFMFPEQPVGTLVT
TVTGSSLRGEPLSYYIASGNLGNTFQIDQSTGQVSISQPLDFEKIQKYVIRIEARDGGFP
PFSSYEKLDITVLDVNDNSPVFKEDPFVAEILENLSPRKILAVSAVDKDSGPNGQLDYEI
INGNEENSFSINHATGEIRSVRPLDREKVSHYVLTVKSSDKGSPSRSASVKVIINILDEN
DNAPRFSQIFSAQVPENSPLGYTVTRVTTSDEDIGVNAISRYSIMDTSLPFTIHPSTGDI
IISRPLNREDTDRYRIRVSAHDSGWTVSTDVTIFVTDVNDNAPRFSRPSYYLDCPELTEI
GSRVTQVSATDPDEGSNGQVFYFIKSQSEYFRINATTGEIFNKQVLKYQNVSGFSNVNVN
RHSFIVTSSDRGNPSLLSETTVTINTVDSNDNAPEFLQTQYFTPVTKNVKIGTKLIKVTA
IDNKDFGLNSEVDYFISNGNHLGKFKLDTNTGWISIASSLISDLNQNFLLTVTAKDKGNP
PLSSQATVEITVTEENYHTPEFSQSHLSATIAESQSVGTIIRTVSARDRDAAMNGLIRYS
ISSGNEEGIFAINSSTGVLTLAKPLDYELYQKHEMTVSAIDGGWVARTGYCSVTINVIDV
NDNSPIFIPDEYFPTVLENAPSGTTVIHLNATDADSGTNAVIAYTVQTSDSDLFVIDPNT
GVITTQGFLDFETKQSYHLPVKAFNVPDEERCSFATVNIQLKGTNEYVPRFVSKLYYFEI
SEAAPRGTVVGEVFASDRDLGTDGEVHYLIFGDSRKKGFQINKRTGQIYVSGLLDREKEE
RVSLKVLAKNFGSIRGADIDEVTVNITVLDANDPPVFSLNIYSVQISEGVPIGTHVTFVS
AFDSDSIPSWSRFSYFIGSGNENGAFSVNPQTGQITVTAELDRETLPIYNLTVLAVDSGT
PSATGSASLIVTLEDINDNGPTLSISEGEVMENKRPGTLVMTLQSTDPDLPPNQGPFTYY
LLSTGPATNYFSLNTAGVLSTTREIDREQISDFYLSVVTRDSGIPQMSSTGTVHITVMDE
NDNPSQSRTVELFVNYYGNLFPGGILGSVKPQDPDVLDSFHCSLTSGVTSLFSIPVGTCD
LHSQPRSTDGTFDLTVLSNDGVHSTVTSNIRVFFAAFSNTTVDNSILLRVSVPTVKDFLT
NHYLHFLRIASSQLTGLGTAVQLYGAYEDNNRTFLLAAVKRNNNQYVNPSGVATFFESIK
DILLRQSGVKVESVDHDSCIHGPCQNGGSCIRRLAVSSVLKSYESLPVIIMANEPLQPFL
CKCLPGYAGNWCETDIDECLPSPCHNGGTCHNLVGGFSCSCPEGFTGRACERDINECLPS
PCKNGAVCQNFPGGFNCVCKTGYTGKTCESSVNYCECNPCFNGGSCQSGVDSYYCHCPFG
VFGKHCELNSYGFEELSYMEFPSLDPNNNYIYVKFSTIKSHALLLYNYDNQTGDRAEFLA
LEIAEERLRFSYNLGSGTYKLTTMKKVSDGHFHTVIARRAGMXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFLIGKNGTVTISVDRIYNRDI
IHTTQDFGGLEVLTMSLGGIPPNQAYRDTQTAGFDGCIASMLYGGESLPFSGKHSLASIS
KTDPSVKIGCRGPNICASNPCWGDLLCINQWYAYKCVPPGDCASHPCQNGGSCEPGLHSG
FTCSCPESHTGRTCETVVACLGILCPPGKMCKAGSPGGHVCVPTQGPEEISLPLWAVPAI
VGSCATVLALLVLSLILCNQCRGKKPKNHKGEKKPKEKKKKGSENVAFDDPDNIPPYGDD
MTVRKQPEGNPKPDIIERENPYLIYDETDIPHNSETIPSAPLASPEQEIEHYDIDNASSI
APSDADIIQHYKQFRSHTPKFSIQRHSPLGFARQSPMPLGASSLTYQTSYGPGLRTSSLS
HSACPTPNPLSRHSPAPFSKSSSFYRNSPARELHLPIRDGSTLELHGEACQPGLFNYATR
LGRRSKSPQAMASHGSRPGSRLKQPIGQIPLESSPPVGLSIEEVERLNTPRPRNPSICSA
DHGRSSSEEDCRRPLSRTRNPADGIPAPESSSDSDSHESFTCSEMEYDREKPMVYTSRMP
KLSQVNESDADDEDNYGARLKPRRYHGRRPEGGPVGTKAAAPGGADSTLPMKLGQQAR
Download sequence
Identical sequences ENSOPRP00000000519 ENSOPRP00000000519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]