SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000000744 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000000744
Domain Number 1 Region: 318-375
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.34e-25
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 2 Region: 208-265
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.41e-25
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 3 Region: 5-65
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.7e-23
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 4 Region: 430-487
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.4e-23
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 5 Region: 374-431
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.52e-23
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 6 Region: 171-222
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.51e-20
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 7 Region: 268-319
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.42e-20
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 8 Region: 114-166
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.54e-18
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 9 Region: 77-129
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.35e-17
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 10 Region: 476-527
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000543
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 11 Region: 530-582
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000393
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000000744   Gene: ENSOPRG00000000811   Transcript: ENSOPRT00000000813
Sequence length 596
Comment pep:novel genescaffold:pika:GeneScaffold_4844:407:63064:1 gene:ENSOPRG00000000811 transcript:ENSOPRT00000000813 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEHQSKGAVSFKDVMVVFTPEEWQHLDSCQRSLYRDVMLEIYSHLVSVGFCVYKPEVIFR
LEQGEEPWTLEEEFSNQRLPEHQRIHTGENLHECSQCKKAFCQRSSLIKHQRIHTGENLH
ECTQCKKAFCQKSHLVTHQRTHTGEKPYECSECPKTFSDPSSLIRHESTNLYECSDCGKG
FNRISYLTVHQRIHTGEKPYECKECGKAFSHKSALIIHQKIHTREKPYQCPECGKAFCQK
SYLIKHRKIHTGEKPYQCPECGKAFGHMLIIHQRIHTGEKPYQCSECPKSFCGRSSLLKH
QRIHTWVKLYECSECGKAFHRKSYLITHQRVHTGEKPYECSECGKTFSQKSYLITHQGIH
TGENPYECSVCGKVFGCKSYLSMCQRIHTGEKPYECSECKKSFYNRSVLISHQRIHTGEK
PYECKECGKAFGRKSNLKKHEKIHTREKPYECSECGKTFSHKSAFITHQTIHAGEKPYEC
KECGKAFGQKSYLNKHQKIHTREKHMCNDCGKAFCQQSSLVRHQTIHSGKSYEFRDCGKA
FYWKSHLITHQGIYLGEKNYKCGESGKLFRRKSYLITCHKIHTTQEPFYEQYKTFC
Download sequence
Identical sequences ENSOPRP00000000744 ENSOPRP00000000744

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]