SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000001297 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOPRP00000001297
Domain Number - Region: 16-34
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0628
Family CCCH zinc finger 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000001297   Gene: ENSOPRG00000001402   Transcript: ENSOPRT00000001406
Sequence length 174
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_1798:89259:91677:-1 gene:ENSOPRG00000001402 transcript:ENSOPRT00000001406 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEYLASIFGTKKDASFFKSGVCWHRDTCSRLHRKPTISQEVFTELQEKYGETGEMNACN
NGDHLVGNVYIKFQREQCSVAELNKCCFGQAVHGSVPMRASATLCACDPFPGLSSGSCMG
GALGAGHCHGPMLAIDPEKNIGGFLQTTCMAAVETPAFLPFTQDPSLTILFRWG
Download sequence
Identical sequences ENSOPRP00000001297 ENSOPRP00000001297

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]