SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000001329 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000001329
Domain Number 1 Region: 2-226
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 6.8e-69
Family BAR domain 0.000000101
Further Details:      
 
Domain Number 2 Region: 270-329
Classification Level Classification E-value
Superfamily SH3-domain 2.76e-21
Family SH3-domain 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000001329   Gene: ENSOPRG00000001451   Transcript: ENSOPRT00000001443
Sequence length 332
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_2519:84817:136994:1 gene:ENSOPRG00000001451 transcript:ENSOPRT00000001443 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFSEKISGTEGTKLDDEFLDMERKIDVTNKAVTEILSKATEYLQPNPAYRAKLGMLNTVS
KIRGQVKTTGYPQTEGLLGDCMLKYGRELGDDSTFXXXXXXXXXXMKLMAEVKDSLDINV
KQTFIDPLQLLQDKDLKEIGHHLKKLEGRRLDYDYKKKRVGKIPDEEVRQAVEKFEESKE
LAERSMFNFLENDVEQVNQLAVFVEAALDYHKQSTEILQELHTKLQIRISAASSIPRREY
RPRPVKRSSSELNGVSTTSMAKTSGSNASMDQPCCRGLYDFEPENQGELGFKEGDIITLT
NQIDENWYEGMIRGESGFFPINYVEVIVPLPQ
Download sequence
Identical sequences ENSOPRP00000001329 ENSOPRP00000001329

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]