SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000001570 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000001570
Domain Number 1 Region: 155-281
Classification Level Classification E-value
Superfamily Cadherin-like 5.14e-26
Family Cadherin 0.00027
Further Details:      
 
Domain Number 2 Region: 381-496
Classification Level Classification E-value
Superfamily Cadherin-like 5.37e-21
Family Cadherin 0.017
Further Details:      
 
Domain Number 3 Region: 489-597
Classification Level Classification E-value
Superfamily Cadherin-like 5.37e-20
Family Cadherin 0.0016
Further Details:      
 
Domain Number 4 Region: 269-384
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-17
Family Cadherin 0.0036
Further Details:      
 
Domain Number 5 Region: 78-167
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000186
Family Cadherin 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000001570   Gene: ENSOPRG00000001696   Transcript: ENSOPRT00000001700
Sequence length 799
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_4817:82288:540878:-1 gene:ENSOPRG00000001696 transcript:ENSOPRT00000001700 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPERLVGVLLDLWTPFIVLWITLPPCVYTAPMNQSQVLMSGSPLELNRLSEAQRILNRSK
RGWVWNQMFVLEEFSGPEPILVGRLHTDLDPGSKKIKYILSGDGAGTIFQINDVTGDIHA
IKRLDREEKAEYTLTAQAVDWETNKPLEPPSEFIIKVQDINDNAPEFLNGPYHATVPEMS
ILGTSVTNVTATDADDPVYGNSAKLVYSILEGQPYFSIEPETAIIKTALPNMDREAKEEY
LVVIQAKDMGGHSGGLSGTTTLTVTLTDVNDNPPKFAQXXXXXXXXXXXXXXXXIGRVKA
NDQDIGENAQSSYDIVDGDGIALFEITSDAQAQDGIIRLRKPLDFETKKSYTLKVEATNV
HIDPRFSGTVPFRDTATVKIVVEDADEPPVFSSPTYLLEVHENAALNSVIGQVTARDPDI
TSSPIRFSIDRHTDLERQFNINADDGKITLATPLDRELSVWHNITIIATEIRNHSQISRV
PVAIKVLDVNDNAPEFASEYEAFLCENGKAGQVIQTVSAMDKDDPKNGHYFLYSLLPEMV
NNPNFTIKKNEDNSLSIFAKHNGFNRQKQEVYLLPIIISDSGNPPLSSTSTLTIRVCGCS
SDGVVQSCNVEAYVLPIGLSMGALIAILACIILLLVIVVLFVTLRRHKNEPLIIKDDEDV
RENIIRYDDEGGGEEDTEAFDIATLQNPDGINGFLPRKDIKPDLQFMPRQGLAPVPNGVD
VDEFINVRLHEADNDPTAPPYDSIQIYGYEGRGSVAGSLSSLESTTSDSDQNFDYLSDWG
PRFKRLGELYSVGESDKET
Download sequence
Identical sequences ENSOPRP00000001570 ENSOPRP00000001570

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]