SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000001628 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000001628
Domain Number 1 Region: 560-678
Classification Level Classification E-value
Superfamily Cadherin-like 7.2e-31
Family Cadherin 0.0019
Further Details:      
 
Domain Number 2 Region: 240-365
Classification Level Classification E-value
Superfamily Cadherin-like 1.7e-30
Family Cadherin 0.00079
Further Details:      
 
Domain Number 3 Region: 463-564
Classification Level Classification E-value
Superfamily Cadherin-like 3.43e-28
Family Cadherin 0.0013
Further Details:      
 
Domain Number 4 Region: 136-244
Classification Level Classification E-value
Superfamily Cadherin-like 6.42e-23
Family Cadherin 0.0035
Further Details:      
 
Domain Number 5 Region: 668-776
Classification Level Classification E-value
Superfamily Cadherin-like 1.36e-17
Family Cadherin 0.012
Further Details:      
 
Domain Number 6 Region: 352-461
Classification Level Classification E-value
Superfamily Cadherin-like 2.28e-16
Family Cadherin 0.0074
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000001628
Domain Number - Region: 29-122
Classification Level Classification E-value
Superfamily Cadherin-like 0.000173
Family Cadherin 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000001628   Gene: ENSOPRG00000001771   Transcript: ENSOPRT00000001764
Sequence length 1237
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_4593:3727:87360:-1 gene:ENSOPRG00000001771 transcript:ENSOPRT00000001764 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLRDFYLLAALIACLRLDSAIAQELIYTIREELPENVPIGNIPKDLNISHINAATGTSA
SLVYRLVSKAGDAPLVRVSSSTGEIFTTSNRIDREKLCAGAAYAEENECFFELEVVILPN
DFFRLIKIKIVVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYE
LLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQV
TVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADVGSNAEIRYIFGAQVAPATK
RLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTPARATVTINVTDVNDNPPNIDL
RYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIEREVPFHLKAVYDNQYL
LETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFSQPVIELSVSE
NNRRGLYLTTISATDEDSGKNADIVYQLGPNASFFDLDRKTGVLTASRVFDREEQERFIF
TVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDAD
AGENKAVTLSILNDNDNFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAK
VTINVMDVNDNSPVVISPPSNTSFKLVPLSAIPGSVVAEVFAVDIDTGMNAELKYTIVSG
NNKGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGYPKSLHTLVLVFLYVNDTAGN
ASYIYDLIRRTMETPLDRNIGDSSQPYQNEDYLTIMIAIVAGAMVVIVVIFVTVLVRCRH
ASRFKAAQRSKQGAEWMSPNQEHKQNKKKKRKKRKSPKSSLLNFVTIEESKPDDAVHEPI
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCNSHSKSD
NIPVTPQKCPSSAGFHVQESEESHSEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGPLGPRGLAEATEMCTQECLVLGHSD
NCWMPPGLGPYQHPKSPLSTFAPQKEWAKKDKLVNGHTLTRAWKEDSNRNQFNDRKQYGP
NEGHFNNGSHMTDIPLANLKSYKQAGGAIESPKEHQL
Download sequence
Identical sequences ENSOPRP00000001628 ENSOPRP00000001628

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]