SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000001742 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000001742
Domain Number 1 Region: 104-161
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000222
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Domain Number 2 Region: 905-963
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000275
Family TSP-1 type 1 repeat 0.0041
Further Details:      
 
Domain Number 3 Region: 675-741
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000667
Family TSP-1 type 1 repeat 0.0032
Further Details:      
 
Domain Number 4 Region: 796-850
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000275
Family TSP-1 type 1 repeat 0.0078
Further Details:      
 
Domain Number 5 Region: 850-910
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000301
Family TSP-1 type 1 repeat 0.0032
Further Details:      
 
Domain Number 6 Region: 618-678
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000275
Family TSP-1 type 1 repeat 0.0088
Further Details:      
 
Domain Number 7 Region: 743-793
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000405
Family TSP-1 type 1 repeat 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000001742   Gene: ENSOPRG00000001882   Transcript: ENSOPRT00000001888
Sequence length 1007
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_4774:23152:45289:1 gene:ENSOPRG00000001882 transcript:ENSOPRT00000001888 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFEAGQGGGPAGRGPGQERGCSRAAPAAHLAGPWPGEDDLPSGQGPRRSLVAALLPRMDG
WQYPRWAWSLLAVAVVAGGAASTEATHNSPTSNSLEGGTDATASWWGEWTKWTACSRSCG
GGVMSQERHCLQQRHKSVSGAGNRTCTGTPRRYQLCHMQECPPDGRSFREEQCVSFNSHV
YNGRTYQWKPLYPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYSLVTHIPAGARDIQI
VERRKSADVLALADETGFYFFNGNYKVDSPKNFNIAGTVVKYRRPMDVYETGIEYIVAQG
PTNQGLNVMVWNQNGKSPSITFEYTLLQPPHTHRLQPLYYGFAEPVSDSTESQELGRAGL
LSFLQHNSSLYGPASSERLGLDNQLFGPPGPEMELGLGRGPQTNEVCEPASGSSGACQGA
PRGQGFRDHNTTGSALAGDEGDQEMDTHFTSRGFLSANAISGQLLGTGSDSKEFALNETM
NSILAPGGPRNAPAEILHAAHQEREEGGAYLELSSEPLANSSSEAPFPNTSASLPTSGGN
RTHKARTRPKARKQGVSPADMYRWKLSSHEPCSATCTTGVMSTYAMCVRYDGVEVDDSHC
DALTRPEPVHEFCAGRECQPRWETSSWSECSRTCGEGYQFRIVRCWKMLSPGFDSSVYSD
LCEAAEAVRPEERKVCRNPACGPQWEMSEWSECTARCGEHSVVTRHIRCSEDEKLCDPNT
RPVGEKNCTGPPCDRQWTASDWGPCSGSCGQGRTIRHVYCKTSDGHVVPESQCQMETKPL
AIHPCGDKNCPAHWLAQDWERCNTTCGRGVKKRLVLCMELANGKPQTRSGPECGLAQKPA
EETTCFERPCFKWYTSAWSECTKTCGVGMRMRDVKCYQGTDIVRGCDPLVKPVGRQACDL
QPCPTEPPDDSCQDQPGTNCALAIKVNLCTHWYYSKACCRSCRPPRS
Download sequence
Identical sequences ENSOPRP00000001742 ENSOPRP00000001742

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]