SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000002450 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000002450
Domain Number 1 Region: 40-125
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 5.49e-21
Family SCAN domain 0.0017
Further Details:      
 
Domain Number 2 Region: 340-396
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.58e-19
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 3 Region: 303-353
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000182
Family Classic zinc finger, C2H2 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000002450   Gene: ENSOPRG00000002665   Transcript: ENSOPRT00000002657
Sequence length 424
Comment pep:known_by_projection scaffold:pika:scaffold_11406:37043:39177:1 gene:ENSOPRG00000002665 transcript:ENSOPRT00000002657 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALDLGFSLTRASSRNCLNTDTPQFQKDQKPAVQMEDSSTSSTTVSSFQFNGNLGARQEL
ARLRDFFYSWLQPEKHSKEEMISQLVIEQFLMSGHCRDRAALIQQWESRGRNLQTLIEDL
DDDSRNPLVHVCMQGHQAFFSENMPLKEVISLFTKQMPAGAPTEDSTSIHIHAPQTSVAA
AAFADPEDGYGISVQTTQNGTVTTHDSHTTSFVITLEMVGCPTQNEESVSSENPHNSRRA
EPAVDGSQESSLERPSDPQDPAEVPAECSSRPDESIPKPEQSQKGNSTHNRCQKRSHKAP
QSLKCDQCNMTFKFSCKLLAHKRRHRNERPFACDQCHKCFFQSSDLRVHQRTHSEEKMYQ
CSTCMASFSHVTNLKAHERIHTGEKPYLCSICQKRFRQSSTYHRHLRMHQNAALKPHSFP
DTSS
Download sequence
Identical sequences ENSOPRP00000002450 ENSOPRP00000002450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]