SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000002461 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000002461
Domain Number 1 Region: 25-222
Classification Level Classification E-value
Superfamily L domain-like 1.22e-22
Family Ngr ectodomain-like 0.0018
Further Details:      
 
Domain Number 2 Region: 260-366
Classification Level Classification E-value
Superfamily Immunoglobulin 4.34e-17
Family I set domains 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000002461   Gene: ENSOPRG00000002675   Transcript: ENSOPRT00000002669
Sequence length 498
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_3806:26090:30389:-1 gene:ENSOPRG00000002675 transcript:ENSOPRT00000002669 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPVALVLLLLLLLLPQPLSPPARADACPAACRCYSTTIECGALQLHGVPPGIPAGTQTL
FLQDNSIVRLEAGALAPLTALRRLYLHNNSLRALRGAFRAQPHLLELXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRLQELHLQDNSLELLEEQALEGLSSLALLD
LSRNQLGTISRETLRPLASLQVLRLTENPWRCDCALHWLGAWIKEGGQRLLGARGRRITC
AEPPRLALQSLLDVSGSSLVCIPPSVHVEPPELTANLGDDLRVACRASGYPQPLVTWRKA
PLPRDSRPRVRAQWEGAAPGPPEPAAADTGSGMLFLSNVTLAHAGRYECEAANAGGAARV
PFRLLVNASRQAHHPPLPAHPDGGEPQPEPGSLAFRALGLATQTAVAAAIALLALTALLL
AAMICRRRRRRKKGCVPPGEGVLFANDYSDGPCTSAQLEELRGERGHAMFVINRSKPLLT
EGPAEDCTQPHRAYEIHC
Download sequence
Identical sequences ENSOPRP00000002461 ENSOPRP00000002461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]