SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000002682 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000002682
Domain Number 1 Region: 460-579
Classification Level Classification E-value
Superfamily Cadherin-like 8.77e-27
Family Cadherin 0.0008
Further Details:      
 
Domain Number 2 Region: 128-239
Classification Level Classification E-value
Superfamily Cadherin-like 6.85e-24
Family Cadherin 0.0019
Further Details:      
 
Domain Number 3 Region: 234-354
Classification Level Classification E-value
Superfamily Cadherin-like 5.71e-21
Family Cadherin 0.005
Further Details:      
 
Domain Number 4 Region: 569-679
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000857
Family Cadherin 0.002
Further Details:      
 
Domain Number 5 Region: 40-134
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000186
Family Cadherin 0.019
Further Details:      
 
Domain Number 6 Region: 347-464
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000113
Family Cadherin 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000002682   Gene: ENSOPRG00000002896   Transcript: ENSOPRT00000002912
Sequence length 860
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_5106:61695:81727:1 gene:ENSOPRG00000002896 transcript:ENSOPRT00000002912 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRNPWAALALGQLFPCLALANFAPHFFDNGVGSTNGNMALFSLPEDTPVGSHGYTLNTD
PEGEPVSYHISFDPSARSVFSVDPTLGNITLVEELDREREDEIEAIISISDGLNLVAEKV
TILVTDANDEAPQFIQEPYVILVPEDIPPGSSIFTVHAVDKDTGSGGSVTYFLQNLHPSK
FAVDRHSGVLRLQTGATLDYEKSRAHFITVVAKDGGGRLREADVVFSATATVTVTVEDVQ
DMPPVFVGTPYYGYVYEDTLPGSEVLTVVAMDGDRGNPNRILYNLVNGSDGAFEINETSG
TIFVTQSPAQLQREMYELHVQVTEISSAGSPGDQAMAPITIRVVDLNNHPPTFYGESGPQ
NRFELTMYEHPPQGEILRGLKITVNDSDQGANAKFNLRLVGPGGIFRVVPQTVLNEAQVT
IIVENSAAIDFEKYNVLAFKLLAVEVNTPEKFSSTADVVIQLQDTNDNDPTFTSHYYIAR
IPENTPGGTHVVAVTAMDPDTGPWGEVKYSISGSEADLFLIHSATGLIYTQPWASLDAEV
TSRYNFFVKAEDMEGRSGLAEVCVTVLDVNDHYPQFGKSIQEKTMVLGVPVRIEATDQDA
EEPNNLVDYSITHAEPANVFDIDPHTGEIRLKNSISSLEVLHNITPSGEDCTWSLQVRAK
DRGSPSFSTTALLKIDITDAETLSRDPMTAFLIQTKDNPMKAVGVLAGIMATVVAITIII
STATFWRNKKSNKVLPVRRVIRKRPSPAPRAVRIEWLKSRKAKAATKFMLKEDPPNENYN
NHNPVSPLPPTAPALPPPASSPPNTATAHWTVPTISGSLSSPEPQELSEPKTSGTPVRST
LVSELKQKFEKKSRDNKAYF
Download sequence
Identical sequences ENSOPRP00000002682 ENSOPRP00000002682

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]