SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000002705 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000002705
Domain Number 1 Region: 333-595
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.3e-72
Family Nuclear receptor ligand-binding domain 0.000000000109
Further Details:      
 
Domain Number 2 Region: 260-338
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.36e-28
Family Nuclear receptor 0.000014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000002705   Gene: ENSOPRG00000002948   Transcript: ENSOPRT00000002936
Sequence length 597
Comment pep:known_by_projection scaffold:pika:scaffold_13069:34798:39242:-1 gene:ENSOPRG00000002948 transcript:ENSOPRT00000002936 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPCVQAQYGSSPQGASPASQSYSYHSSGEYSSDFLTPEFVKFSMDLTNTEITATTSLPSF
STFMDNYSTGYDVKPPCLYQMPLSGQQSSIKVEDIPMHNYQQHSHLPPQSEEMMPHSGSV
YYKPSSPPTPTTPGFQVHSAMWDDPGSLHNFHXXYVATTHMIEQRKTPVSRLSLFSFKQS
PPGTPVSSCQMRFEGPLHVPLNPEPAGSHHVVDGQTFAVPNPIRKPASMGFPGLQIGHAS
QLLDTQVPSPPSRGSPSNEGLCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCLA
NKNCPVDKRRRNRCQYCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKSPQEPSPPSPP
VSLISALVRAHVDSNPAMTSLDYSRFQANPDYQMSGDDTQHIQQFYDLLTGSMEIIRGWA
EKIPGFADLPKADQDLLFESAFLELFVLRLAYRSNPVEGKLIFCNGVVLHRLQCVRGFGE
WIDSIVEFSSNLQNMNIDISAFSCIAALAMVTERHGLKEPKRVEELQNKIVNCLKDHVTF
NNGGLNRPNYLSKLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPAIIDKLFLDTLPF
Download sequence
Identical sequences ENSOPRP00000002705 ENSOPRP00000002705

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]