SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000003025 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000003025
Domain Number 1 Region: 205-262
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.69e-27
Family Classic zinc finger, C2H2 0.0025
Further Details:      
 
Domain Number 2 Region: 261-318
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.86e-26
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 3 Region: 317-374
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.79e-25
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 4 Region: 47-99
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.66e-21
Family KRAB domain (Kruppel-associated box) 0.0022
Further Details:      
 
Domain Number 5 Region: 374-421
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.17e-20
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 6 Region: 170-219
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000138
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000003025   Gene: ENSOPRG00000003308   Transcript: ENSOPRT00000003296
Sequence length 443
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_2800:166690:172777:-1 gene:ENSOPRG00000003308 transcript:ENSOPRT00000003296 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METQADRVLQEPQALLESALSASKVPTFSDKDSLGDEMLAAALLKAKSQELVTFEDVAVY
FIWKEWKRLEPAQRSLYRDVMLENYGNVFSLDGETRTENKQDISQERGSHGVLLGRFQKD
ISQGLKFEEAYKQEVSLKKQLGHSSGKRLNRKMQVTVGEKFTPTEQRSEKYNEFDSSFTV
SPNLISHQRLPMGDRPHKCDECSKSFNRTSDLIQHQRIHTGEKPYECSECGKAFSQSSHL
IQHQRIHTGEKPYECNDCGKTFSCSSALILHRRIHTGEKPYECNECGKTFSWSSTLTHHQ
RIHTGEKPYACNECGKAFSRSSTLIHHQRIHTGEKPYECNECGKAFSQSSHLYQHQRIHT
GEKPYECMECGGKFTYSSGLIQHQRIHTGENPYECSECGKAFRYSSALVRHQRIHTGEKP
LNVTGMSKSSLRVPAELNIREST
Download sequence
Identical sequences XP_004586959.1.84141 ENSOPRP00000003025 ENSOPRP00000003025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]