SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000003089 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOPRP00000003089
Domain Number - Region: 188-211
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0115
Family CCCH zinc finger 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000003089   Gene: ENSOPRG00000003370   Transcript: ENSOPRT00000003367
Sequence length 658
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_2904:67844:94389:1 gene:ENSOPRG00000003370 transcript:ENSOPRT00000003367 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LENCDLSAAVPWPMSENPVVASFNARKEVAKVSEDHGNKEVFSCRGIKLAVDWFLERGHK
DITVFVPAWRKEQSRPDALITDQEILRKLEKEKILVFTPSRRVQGRRVVCYDDRFIVKLA
FESDGIIVSNDNYRDLANEKPEWKKFIDERLLMYSFVNDKFMPPDDPLGRHGPSLDNFLR
KKPIVPEHKKQPCPYGKKCTYGHKCKYYHPERGSQPQRSVADELRAMSRNTVAKTANEGG
LVKSNSVPCSTKADSACDVKRGAPKRQSDPSIRTHVYQDLEEKLPTKNKLETRSVPSLVS
IPATSTAKPQSTTSLSNGLPSGVHFPPQDQRPQGYPPMMVATKNNGTPLPYEPDPKCDSQ
VATGYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXDPQLEENLKCQHMHPHSRHYPTLLQNFHDPLTRVQSYSHEEPKFHHKPPLAH
LAMHLQHPAVGARSSCPGDYPSPPSSTHSKAPHLGRSLVATRIDSISDSRLYDSSPSRQR
KLYSRQEGLGSWERPSYGMEAYGYRQTYSLPDNSTQPCYEQFTFQSLPEQQEQTWRVPYC
AMPQDPPRYQDSREKIYINLCNIFPPDLVRIVMKRNPHMTDAQQLAAAILVEKSQMGY
Download sequence
Identical sequences ENSOPRP00000003089 ENSOPRP00000003089

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]