SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000003141 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000003141
Domain Number 1 Region: 629-747
Classification Level Classification E-value
Superfamily Cadherin-like 3.01e-28
Family Cadherin 0.0018
Further Details:      
 
Domain Number 2 Region: 531-632
Classification Level Classification E-value
Superfamily Cadherin-like 1.7e-27
Family Cadherin 0.0013
Further Details:      
 
Domain Number 3 Region: 205-314
Classification Level Classification E-value
Superfamily Cadherin-like 2.14e-21
Family Cadherin 0.0019
Further Details:      
 
Domain Number 4 Region: 314-417
Classification Level Classification E-value
Superfamily Cadherin-like 4.45e-18
Family Cadherin 0.0034
Further Details:      
 
Domain Number 5 Region: 736-846
Classification Level Classification E-value
Superfamily Cadherin-like 1.1e-17
Family Cadherin 0.0066
Further Details:      
 
Domain Number 6 Region: 448-536
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000107
Family Cadherin 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000003141   Gene: ENSOPRG00000003442   Transcript: ENSOPRT00000003423
Sequence length 952
Comment pep:known_by_projection scaffold:pika:scaffold_7967:6519:10524:-1 gene:ENSOPRG00000003442 transcript:ENSOPRT00000003423 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGRGNAPSLRTLAVSWRPATWHLRLDMGHLHRPRSSADHRNLPHLFLFLLFVGPFNCLA
SYSRATELLYSLNEGLPAGVLIGSLAEDLRLVPRAAGRQDQRSQQSDRTRAEWNPPLSFS
LASGGLSGQYVTLDNRSGELHTSAQEIDREALCLEGGGEAAWGGSVSIFSSPSSDSCLLL
LDVLVLPQEYFRFVKVKIAIRDINDNAPQFPVSQISVWVPENAPVNTRLAIEHPAVDPDI
GMNGVQTYRLLDYHGMFTLDVEENENGERTPYLIVMGSLDRETQDHYVSIIIAEDGGSPP
LMGSATLTIGISDVNDNCPLFMDSQINVTIYGNATVGTPIAAVQAVDRDLGTNAQITYSY
SQKVPQASKDLFHLEETTGVIKLFSKIGGGVLQTHKLTILANGPGCIPAVITALVSIIKV
TLRPPEIVPRYIANEIDGVVYLKELEPIHTPVAFFTIRDPEGKQKVNCYLDGEGPFRLSP
YKPYNNEYLLETTKPMDYELQRFYEIAVVAWNSEGFHAKRIIKVQLLDDNDNAPVFLQPL
IELTIEENNPPNAFLTKLYATDADSGERGQVLYFLGPDAPSYFSLDNVTGILTVSTQLDR
EEKEKYRYTVRAVDCGKPPKESVATVALTVLDKNDNSPRFINKDFSFFVPENFPGYGEIG
VISVTDADAGRNGWVALSVVNQSDIFVIDTGKGMLRAKVSLDREQQSSYTLWVEAVDGGE
PALSSTTKITILLLDINDNPPLVLFPQSNMSYLLVLPSTLPGSPVTEVYAVDKDTGMNAV
IAYSIIGRRGPRPESFRIDPKTGNITLEEALLQTDYGLHRLLVKVSDHGYPEPLHSTVMV
NLFVNDTVSNESYIESLLRKEPEINIEEKEPQISIEPTHRKVESVSCVPTLVALSVISLG
SITLVTGMGIYICLRKEKKPHREDDNLEVQIPLKGKIDLHMRERKPMDISNI
Download sequence
Identical sequences ENSOPRP00000003141 ENSOPRP00000003141

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]