SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000003148 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000003148
Domain Number 1 Region: 238-420
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.44e-50
Family Nuclear receptor ligand-binding domain 0.0000000101
Further Details:      
 
Domain Number 2 Region: 134-219
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.87e-28
Family Nuclear receptor 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000003148   Gene: ENSOPRG00000003439   Transcript: ENSOPRT00000003430
Sequence length 421
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_2705:457454:521225:1 gene:ENSOPRG00000003439 transcript:ENSOPRT00000003430 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VGKTLGDAPVDAERDCFTDWSASAVQEITMVDTESFWPTNFGISSVDLSVVDDHSHSFDI
KPFTTVDFSSISAPHYEDIPFTRSDPMVPDYKYDLKLQEYQSAIKVEPASPPYYSEKTQL
YSKAHEETCSSLMAIECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYDRCDLNCRI
HKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEISSDIDQLNPESADLRAL
AKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQS
KEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLM
NKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILS
G
Download sequence
Identical sequences ENSOPRP00000003148 ENSOPRP00000003148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]