SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000003244 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOPRP00000003244
Domain Number - Region: 248-288
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.00445
Family Frizzled cysteine-rich domain 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000003244   Gene: ENSOPRG00000003529   Transcript: ENSOPRT00000003530
Sequence length 576
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_2800:275768:281108:-1 gene:ENSOPRG00000003529 transcript:ENSOPRT00000003530 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVLRPLLLLLLPLCPGPGPGQGSEAKVTRSCAETRKVLGARKYSLDLIPSTLISGEHLR
VCPQEYTCCSSETEQRLIRDTEATFQGLVESSGSFLAQSLAARHKKFNEFFQETLSISQH
SLQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXITRSMVAARAFIQGLETGRNVVRET
FKMPVSDSCSRALMRLVGCPLCRGVPSLAPCRGFCLNVVHGCLSNMGLEPDWGSYLDGLL
LLAEKLQGPFSFELAMESIGIKISEGLMYLQENSVKVTEKAFQQCGTPHPVSTRYRRAPA
PWEEVGRPWRPAAEEERPTTAAGTNMQRLVWDLRERLGRARGFWTGLPTTVCGDSRMAAD
ISQEAAPCWTGTGRGRYMPPVVGSSITEQFQNPELELDASGPDLPTRRRRLQLRAATARM
QAAALGHDLDRHDEDEDASGSGGGQHYADDWKAGPEPLAPLGRPLLPPRREGPGNRGGGS
ARYNQGRSSSEGTSFVFHSQPALLFLPSALALLGPR
Download sequence
Identical sequences ENSOPRP00000003244 ENSOPRP00000003244

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]